Property Summary

NCBI Gene PubMed Count 54
PubMed Score 448.33
PubTator Score 58.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.048 1.3e-04
adult high grade glioma -2.300 3.5e-06
astrocytic glioma -1.500 1.2e-02
Astrocytoma, Pilocytic -1.700 3.5e-07
atypical teratoid / rhabdoid tumor -2.400 2.8e-08
autosomal dominant Emery-Dreifuss muscul... 1.093 3.2e-03
ependymoma -1.800 1.5e-02
glioblastoma -1.700 2.8e-07
hereditary spastic paraplegia -1.142 5.3e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.4e-02
lung cancer 1.500 5.5e-03
malignant mesothelioma 1.300 1.0e-05
medulloblastoma -1.200 1.0e-04
medulloblastoma, large-cell -1.100 3.5e-04
mucosa-associated lymphoid tissue lympho... 1.487 5.5e-03
osteosarcoma -1.647 1.4e-06
ovarian cancer -1.400 5.3e-09
pituitary cancer 1.200 6.5e-05
primitive neuroectodermal tumor -1.200 2.8e-03
spina bifida -1.213 2.9e-02

Gene RIF (33)

AA Sequence

MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEESRSEIYGLVQ      1 - 70
RCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYV     71 - 140
ALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPGASGNMERITSPVLMGEENNVVHNQKVEILR    141 - 210
KMLQKEQERLQLLQEDYNRTPAQRLLKEIQEAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSE    211 - 280
AETDPGDVLGRTDCSSGDASRPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHI    281 - 350
IGAEDDDFGTEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRR    351 - 420
IFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMG    421 - 490
LTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKVK    491 - 560
EPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSILGPPRRPSRHDNSAIGRAMELQKARHPKHL    561 - 630
STPSSVSPEPQDSAKLRQSGLANEGTDAGYLPANSMSSVASGASFSQEGGKENDTGSKQVGETSAPGDTL    631 - 700
DGTPRTLNTVFDFPPPPLDQVQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQ    701 - 770
QLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ    771 - 840
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQT    841 - 910
FVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNYVNQAVKE    911 - 980
AENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLL    981 - 1050
QKQDDRLVLRCHSKILASTADSKHTFSPVIKLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEK   1051 - 1120
TVWQDLICRMAASVKEQSTKPIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISS   1121 - 1190
KPQSHSLSTSGKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLK   1191 - 1260
QLLVQQLGLTEKSVQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTGDIATCYSPRT   1261 - 1330
STESFAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEHFFDAREAHSDENPSEGDGAV   1331 - 1400
NKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQPMTGIPAVESTHQQQHSPQNTHSDGAISPF   1401 - 1470
TPEFLVQQRWGAMEYSCFEIQSPSSCADSQSQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKH   1471 - 1540
SDKS                                                                     1541 - 1544
//

Text Mined References (65)

PMID Year Title