Property Summary

NCBI Gene PubMed Count 29
PubMed Score 32.20
PubTator Score 497.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (14)

Disease log2 FC p
breast carcinoma -1.300 2.0e-03
colon cancer -1.600 2.1e-03
ductal carcinoma in situ -1.700 1.7e-03
fibroadenoma -1.600 1.7e-02
glioblastoma 1.200 3.0e-04
group 3 medulloblastoma -1.200 1.5e-03
invasive ductal carcinoma -2.400 1.4e-03
lung cancer -1.100 2.7e-03
lung carcinoma -1.100 3.0e-14
osteosarcoma 1.469 2.9e-04
ovarian cancer 1.200 3.8e-05
pediatric high grade glioma 1.100 1.2e-04
Polycystic ovary syndrome -1.470 7.1e-03
psoriasis -2.900 9.2e-06

Gene RIF (13)

AA Sequence

MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPMVLVAGQYSTG      1 - 70
KTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDKPFRKLNPFGNTFLNRFMCAQ     71 - 140
LPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEFSEAIGALRGH    141 - 210
EDKIRVVLNKADMVETQQLMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFR    211 - 280
DIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISP    281 - 350
GDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAFEGTHMG    351 - 420
PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIW    421 - 490
KLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE                     491 - 543
//

Text Mined References (37)

PMID Year Title