Property Summary

NCBI Gene PubMed Count 26
Grant Count 3
R01 Count 2
Funding $139,731
PubMed Score 27.77
PubTator Score 497.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -2.900 0.000
osteosarcoma 1.469 0.000
glioblastoma 1.200 0.000
lung cancer -2.200 0.000
colon cancer -1.600 0.002
breast carcinoma -1.300 0.002
fibroadenoma -1.600 0.017
pediatric high grade glioma 1.100 0.000
group 3 medulloblastoma -1.200 0.002
Polycystic Ovary Syndrome -1.470 0.007
lung carcinoma -1.100 0.000
ductal carcinoma in situ -1.900 0.001
invasive ductal carcinoma -2.700 0.001
ovarian cancer 1.400 0.000

Synonym

Accession Q9NZN4 B2RDH9 B4DNU6 Q96CB6
Symbols PAST2

Gene

Gene RIF (11)

PMID Text
25875965 Data suggest that the EH-domain containing 2 protein (EHD2) NPF phenylalanine residue is crucial for EHD2 localization to the plasma membrane, whereas the proline residue is essential for EHD2 dimerization and binding.
25758127 EHD2 can inhibit the metastasis of human breast cancer by regulating the epithelial-to-mesenchymal transition markers E-cadherin and N-cadherin.
25557791 Downregulation of EHD2 was associated with migration and invasion by abrogating the expression of Rac1 in breast cancer patients.
24040268 Phosphatidylinositol 4,5-bisphosphate controls EHD2 plasma membrane localization.
23354948 Our results suggested that EHD2 low expression is involved in the pathogenesis of human esophageal squamous cell carcinoma
22679923 EHD2 participates in the sarcolemma repair.
22505029 Confining caveolae to the plasma membrane by EHD2 relied on its capacity to link caveolae to actin filaments.
22448906 Among three EHD proteins (EHD1-EHD3) that were tested, only EHD2 accumulates in the nucleus under nuclear export inhibition treatment.
22323287 Assembly of EHD2 stabilized and constrained caveolae to the plasma membrane to control turnover, and depletion of EHD2, resulting in endocytic and more dynamic and short-lived caveolae.
21756249 EHD2 regulates trafficking from the plasma membrane by controlling Rac1 activity.
More...

AA Sequence

MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPMVLVAGQYSTG      1 - 70
KTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDKPFRKLNPFGNTFLNRFMCAQ     71 - 140
LPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEFSEAIGALRGH    141 - 210
EDKIRVVLNKADMVETQQLMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFR    211 - 280
DIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISP    281 - 350
GDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAFEGTHMG    351 - 420
PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIW    421 - 490
KLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE                     491 - 543
//

Text Mined References (34)

PMID Year Title
25875965 2015 Role of the EHD2 unstructured loop in dimerization, protein binding and subcellular localization.
25758127 2015 Decreased expression and prognostic role of EHD2 in human breast carcinoma: correlation with E-cadherin.
25557791 2015 Role of EHD2 in migration and invasion of human breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24040268 2013 Role of phosphatidylinositol 4,5-bisphosphate in regulating EHD2 plasma membrane localization.
24013648 2013 Molecular composition and ultrastructure of the caveolar coat complex.
23354948 2013 Effects of EHD2 interference on migration of esophageal squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22679923 2012 Sarcolemmal repair is a slow process and includes EHD2.
22505029 2012 Oligomers of the ATPase EHD2 confine caveolae to the plasma membrane through association with actin.
More...