Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
R01 Count 3
Funding $902,576.57
PubMed Score 52.23
PubTator Score 93.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.127 0.049
malignant mesothelioma -3.200 0.000
astrocytic glioma -1.700 0.001
ependymoma -2.000 0.014
esophageal adenocarcinoma -2.400 0.018
glioblastoma -2.100 0.000
oligodendroglioma -1.400 0.000
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.700 0.001
adrenocortical carcinoma -1.566 0.000
pancreatic ductal adenocarcinoma liver m... -1.725 0.001
pediatric high grade glioma -1.900 0.000
spina bifida -1.513 0.032
Pick disease -1.100 0.025
ulcerative colitis 1.200 0.001
ovarian cancer 1.300 0.002

Gene RIF (12)

PMID Text
27189942 the residues Ala-519/Asp-520 of EHD1 and Asn-519/Glu-520 of EHD3 as defining the selectivity of these two paralogs for NPF-containing binding partners
24997812 The EHD3 gene may be associated with the endophenotype of cognitive function in major depressive disorder patients.
24607927 3 SNPs present in the EHD3 gene, of which rs619002 and rs644926 were exclusively associated with female major depressive disorder
24306026 demonstrate Ehd3 growth inhibitory functions in glioma cells in vivo. We suggest that Ehd3 functions as a tumor suppressor gene and loss of its expression is a very common event in gliomas
24019528 evidence that the functions of both EHD1 and EHD4 are primarily in TRE membrane vesiculation, whereas EHD3 is a membrane-tubulating protein.
22406195 EHD3 is a previously unrecognized component of the cardiac remodeling pathway in heart failure.
22337703 The combined effect of the EHD3 and FREM3 genes may play an important role in developing major depressive disorder.
20489164 A new class of cardiac trafficking proteins(EHD1, EHD2, EHD3, EHD4) regulates cardiac membrane protein targeting.
19139087 Our findings support a role for EHD3 in regulating endosome-to-Golgi transport, and as a consequence, lysosomal biosynthetic, but not secretory, transport pathways are also affected
17507647 Rab8a and Myosin Vb colocalize to a tubular network containing EHD1 and EHD3, which does not contain Rab11a.
More...

AA Sequence

MFSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTG      1 - 70
KTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQ     71 - 140
LPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH    141 - 210
EDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFR    211 - 280
DIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISP    281 - 350
GDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHG    351 - 420
PFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADI    421 - 490
DKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVAE                             491 - 535
//

Text Mined References (36)

PMID Year Title
27189942 2016 EHD3 Protein Is Required for Tubular Recycling Endosome Stabilization, and an Asparagine-Glutamic Acid Residue Pair within Its Eps15 Homology (EH) Domain Dictates Its Selective Binding to NPF Peptides.
26226295 2015 SUMOylation of EHD3 Modulates Tubulation of the Endocytic Recycling Compartment.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25686250 2015 Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
24997812 2014 Association between EHD3 gene and the cognitive function of patients with major depressive disorder.
24607927 2014 The gender-specific association of EHD3 polymorphisms with major depressive disorder.
24306026 2014 Ehd3, a regulator of vesicular trafficking, is silenced in gliomas and functions as a tumor suppressor by controlling cell cycle arrest and apoptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
24019528 2013 Differential roles of C-terminal Eps15 homology domain proteins as vesiculators and tubulators of recycling endosomes.
More...