Property Summary

NCBI Gene PubMed Count 29
PubMed Score 55.78
PubTator Score 93.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.566 7.5e-05
adult high grade glioma -1.700 9.8e-06
astrocytic glioma -1.700 5.7e-04
atypical teratoid / rhabdoid tumor -2.400 1.7e-09
ependymoma -2.000 1.4e-02
esophageal adenocarcinoma -2.400 1.8e-02
glioblastoma -1.400 3.3e-05
group 3 medulloblastoma -2.500 1.0e-06
malignant mesothelioma -3.200 1.3e-07
medulloblastoma, large-cell -3.000 8.4e-06
oligodendroglioma -1.400 3.6e-12
ovarian cancer 1.300 2.2e-03
pancreatic ductal adenocarcinoma liver m... -1.725 7.7e-04
Pick disease -1.100 2.5e-02
primitive neuroectodermal tumor -1.700 1.1e-03
spina bifida -1.513 3.2e-02
ulcerative colitis 1.200 1.3e-03
Waldenstrons macroglobulinemia 1.127 4.9e-02

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MFSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTG      1 - 70
KTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQ     71 - 140
LPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH    141 - 210
EDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFR    211 - 280
DIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISP    281 - 350
GDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHG    351 - 420
PFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADI    421 - 490
DKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVAE                             491 - 535
//

Text Mined References (36)

PMID Year Title