Property Summary

NCBI Gene PubMed Count 38
PubMed Score 25.69
PubTator Score 36.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (25)

PMID Text
26903295 GLTSCR2 is crucial for normal cellular function as well as for preventing the development or progression of cancer. The JNK-c-jun axis is indispensible for regulating the activities of GLTSCR2.
26724143 The expression of GLTSCR2 was suppressed in renal cell carcinomas, accentuating the malignant phenotype.
25956029 GLTSCR2 was an upstream negative regulator of the nucleophosmin (NPM)-MYC axis involved in controlling the transcriptional activity of MYC. GLTSCR2 may be a candidate for suppressing the growth of cancer cells stimulated by MYC hyperactivation.
25818168 Data show that tumor sppressor protein GLTSCR2 down-regulates total nucleophosmin (NPM) expression levels by decreasing its protein stability.
25118835 We demonstrated the GLTSCR2 expression decreased with the rise of the grade of cervical lesions; GLTSCR2 may play an important role in carcinogenesis of cervical cancer
24923447 These results suggest that PICT1 employs atypical proteasome-mediated degradation machinery to sense nucleolar stress within the nucleolus.
24735870 Authors confirmed the interaction of PICT-1 with itself by direct yeast two-hybrid assay and also showed self-association of PICT-1 in mammalian cells by co-immunoprecipitation and fluorescence resonance energy transfer assays.
24556985 GLTSCR2 controls cellular proliferation and metabolism via the transcription factor Myc, and is induced by mitochondrial stress, suggesting it may constitute a significant component of the mitochondrial signaling pathway.
24054033 GLTCR2 may play a role in the tumorigenesis, progression and biological behavior in breast cancer.
24045667 Findings suggest that PICT1 has a crucial role in gastric cancer progression by regulating the MDM2-TP53 pathway through RPL11.
More...

AA Sequence

MAAGGSGVGGKRSSKSDADSGFLGLRPTSVDPALRRRRRGPRNKKRGWRRLAQEPLGLEVDQFLEDVRLQ      1 - 70
ERTSGGLLSEAPNEKLFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVP     71 - 140
NAKKLRRKEQLWEKLAKQGELPREVRRAQARLLNPSATRAKPGPQDTVERPFYDLWASDNPLDRPLVGQD    141 - 210
EFFLEQTKKKGVKRPARLHTKPSQAPAVEVAPAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLERQLA    211 - 280
LPATEQAATQESTFQELCEGLLEESDGEGEPGQGEGPEAGDAEVCPTPARLATTEKKTEQQRRREKAVHR    281 - 350
LRVQQAALRAARLRHQELFRLRGIKAQVALRLAELARRQRRRQARREAEADKPRRLGRLKYQAPDIDVQL    351 - 420
SSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL                421 - 478
//

Text Mined References (42)

PMID Year Title
26903295 2016 c-Jun N-terminal kinase regulates the nucleoplasmic translocation and stability of nucleolar GLTSCR2 protein.
26724143 2016 Suppression of GLTSCR2 expression in renal cell carcinomas.
25956029 2015 The Nucleolar Protein GLTSCR2 Is an Upstream Negative Regulator of the Oncogenic Nucleophosmin-MYC Axis.
25818168 2015 GLTSCR2 is an upstream negative regulator of nucleophosmin in cervical cancer.
25118835 2015 The expression of GLTSCR2 in cervical intra-epithelial lesion and cancer.
24923447 2014 Nucleolar stress induces ubiquitination-independent proteasomal degradation of PICT1 protein.
24735870 2014 The nucleolar PICT-1/GLTSCR2 protein forms homo-oligomers.
24556985 2014 GLTSCR2/PICT1 links mitochondrial stress and Myc signaling.
24054033 2013 Downregulation of GLTSCR2 expression is correlated with breast cancer progression.
24045667 2013 PICT1 regulates TP53 via RPL11 and is involved in gastric cancer progression.
More...