Property Summary

NCBI Gene PubMed Count 32
PubMed Score 327.94
PubTator Score 28.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ovarian cancer 8492 5.33834829167741E-8
acute quadriplegic myopathy 1157 7.7623134552421E-7
medulloblastoma, large-cell 6234 8.1369382219182E-7
glioblastoma 5572 4.9460904112685E-6
osteosarcoma 7933 1.01887822877671E-4
psoriasis 6685 1.72073908266791E-4
atypical teratoid / rhabdoid tumor 4369 2.17752373870775E-4
dermatomyositis 967 2.73015354463563E-4
medulloblastoma 1524 0.0013544244428444
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0
Disease Target Count Z-score Confidence
Schistosomiasis 38 4.566 2.3
Fibromyalgia 22 3.006 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma -1.269 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -2.000 0.000
acute quadriplegic myopathy 1.011 0.000
ovarian cancer -1.900 0.000
dermatomyositis 1.400 0.000

Synonym

Accession Q9NZM3 O95062 Q15812 Q9HAK4 Q9NXE6 Q9NYG0 Q9NZM2 Q9ULG4
Symbols SWA
SWAP
SH3D1B
SH3P18
PRO2015

Gene

PDB

1J3T   1UDL   1UE9   1UFF   1UHF   3GF9   3JZY   4IIO  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA EggNOG
C. elegans OMA Inparanoid

Gene RIF (10)

PMID Text
26633357 ITSN2L interacts with RABEP1 and stimulates its degradation in regulation of endocytosis.
23936226 ITSN1 and ITSN2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
23274495 The sequence and structural alignment of ITSN-2L C2 domain with other members of C2 domain protein family indicate its vital cellular roles in membrane trafficking, the generation of lipid-second messengers and activation of GTPases. Moreover, our data show the possible roles of ITSN-2L C2 domain in regulating the activity of Cdc42.
22449706 The ITSN2 interacts with Eps8 and stimulates the degradation of Eps8 proteins.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19622753 ITSN-2L, a guanine nucleotide exchange factor for Cdc42, regulates different steps of caveola endocytosis in ECs by controlling the temporal and spatial actin polymerization and remodeling sub-adjacent to the plasma membrane.
19460752 Knockdown of intersectin 2 (ITSN2; SH3P18) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17696407 We show that the PPLP motif of K15 protein selectively binds the SH3-C domain of an endocytic adaptor protein, Intersectin 2 (ITSN2).
17390067 ITSN2C may be specifically expressed in neurons hinting to a physiologic role in neuronal cell function.
16394100 These results highlight a role of Numb for dendritic spine development and synaptic functions with intersectin and EphB2.

AA Sequence

MMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLAEIWALSDLNK      1 - 70
DGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMGSMPNLSIPQPLPPAAPITSL     71 - 140
SSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLIQPLPIPYSSSTLPHGSSYSLMMGGFGGASIQKAQS    141 - 210
LIDLGSSSSTSSTASLSGNSPKTGTSEWAVPQPTRLKYRQKFNTLDKSMSGYLSGFQARNALLQSNLSQT    211 - 280
QLATIWTLADVDGDGQLKAEEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKM    281 - 350
QEEEPQKKLPVTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL    351 - 420
ELEKRLEKQRELERQREEERRKDIERREAAKQELERQRRLEWERIRRQELLNQKNREQEEIVRLNSKKKN    421 - 490
LHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQL    491 - 560
LNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLDALEKETASKLSEMDSFNNQLKCGNMDDSVL    561 - 630
QCLLSLLSCLNNLFLLLKELRETYNTQQLALEQLYKIKRDKLKEIERKRLELMQKKKLEDEAARKAKQGK    631 - 700
ENLWKENLRKEEEEKQKRLQEEKTQEKIQEEERKAEEKQRKDKDTLKAEEKKRETASVLVNYRALYPFEA    701 - 770
RNHDEMSFNSGDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYVEKMPSSENEKAVSPKKALLPPTVSLSA    771 - 840
TSTSSEPLSSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENLKAQALCSWT    841 - 910
AKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKREEPEALYAAVNKKPTSAAY    911 - 980
SVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA    981 - 1050
SNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSE   1051 - 1120
RATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPS   1121 - 1190
QQWCADLQTLDTMQPIERKRQGYIHELIQTEERYMADLQLVVEVFQKRMAESGFLTEGEMALIFVNWKEL   1191 - 1260
IMSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEDTDFKEFLK   1261 - 1330
KLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSLKLALERAEELCSQVNEGVREKE   1331 - 1400
NSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKELHGFLFNDFLLLTYMVKQFAV   1401 - 1470
SSGSEKLFSSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDEPVFHISHIDRVYTLRTDNINERTAWVQKIK   1471 - 1540
AASEQYIDTEKKKREKAYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQD   1541 - 1610
TLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTG   1611 - 1680
EVWVRFDLQLFEQKTLL                                                        1681 - 1697
//

Text Mined References (45)

PMID Year Title
26633357 2015 ITSN2L Interacts with and Negatively Regulates RABEP1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23936226 2013 Adaptor proteins intersectin 1 and 2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
23274495 2013 Crystal structure of human Intersectin-2L C2 domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
22449706 2012 Human intersectin 2 (ITSN2) binds to Eps8 protein and enhances its degradation.
More...