Property Summary

NCBI Gene PubMed Count 32
Grant Count 53
R01 Count 31
Funding $12,633,508.45
PubMed Score 327.94
PubTator Score 28.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma -1.269 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -2.000 0.000
acute quadriplegic myopathy 1.011 0.000
ovarian cancer -1.900 0.000
dermatomyositis 1.400 0.000

Gene RIF (10)

PMID Text
26633357 ITSN2L interacts with RABEP1 and stimulates its degradation in regulation of endocytosis.
23936226 ITSN1 and ITSN2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
23274495 The sequence and structural alignment of ITSN-2L C2 domain with other members of C2 domain protein family indicate its vital cellular roles in membrane trafficking, the generation of lipid-second messengers and activation of GTPases. Moreover, our data show the possible roles of ITSN-2L C2 domain in regulating the activity of Cdc42.
22449706 The ITSN2 interacts with Eps8 and stimulates the degradation of Eps8 proteins.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19622753 ITSN-2L, a guanine nucleotide exchange factor for Cdc42, regulates different steps of caveola endocytosis in ECs by controlling the temporal and spatial actin polymerization and remodeling sub-adjacent to the plasma membrane.
19460752 Knockdown of intersectin 2 (ITSN2; SH3P18) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17696407 We show that the PPLP motif of K15 protein selectively binds the SH3-C domain of an endocytic adaptor protein, Intersectin 2 (ITSN2).
17390067 ITSN2C may be specifically expressed in neurons hinting to a physiologic role in neuronal cell function.
16394100 These results highlight a role of Numb for dendritic spine development and synaptic functions with intersectin and EphB2.

AA Sequence

MMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLAEIWALSDLNK      1 - 70
DGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMGSMPNLSIPQPLPPAAPITSL     71 - 140
SSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLIQPLPIPYSSSTLPHGSSYSLMMGGFGGASIQKAQS    141 - 210
LIDLGSSSSTSSTASLSGNSPKTGTSEWAVPQPTRLKYRQKFNTLDKSMSGYLSGFQARNALLQSNLSQT    211 - 280
QLATIWTLADVDGDGQLKAEEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKM    281 - 350
QEEEPQKKLPVTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL    351 - 420
ELEKRLEKQRELERQREEERRKDIERREAAKQELERQRRLEWERIRRQELLNQKNREQEEIVRLNSKKKN    421 - 490
LHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQL    491 - 560
LNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLDALEKETASKLSEMDSFNNQLKCGNMDDSVL    561 - 630
QCLLSLLSCLNNLFLLLKELRETYNTQQLALEQLYKIKRDKLKEIERKRLELMQKKKLEDEAARKAKQGK    631 - 700
ENLWKENLRKEEEEKQKRLQEEKTQEKIQEEERKAEEKQRKDKDTLKAEEKKRETASVLVNYRALYPFEA    701 - 770
RNHDEMSFNSGDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYVEKMPSSENEKAVSPKKALLPPTVSLSA    771 - 840
TSTSSEPLSSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENLKAQALCSWT    841 - 910
AKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKREEPEALYAAVNKKPTSAAY    911 - 980
SVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA    981 - 1050
SNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSE   1051 - 1120
RATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPS   1121 - 1190
QQWCADLQTLDTMQPIERKRQGYIHELIQTEERYMADLQLVVEVFQKRMAESGFLTEGEMALIFVNWKEL   1191 - 1260
IMSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEDTDFKEFLK   1261 - 1330
KLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSLKLALERAEELCSQVNEGVREKE   1331 - 1400
NSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKELHGFLFNDFLLLTYMVKQFAV   1401 - 1470
SSGSEKLFSSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDEPVFHISHIDRVYTLRTDNINERTAWVQKIK   1471 - 1540
AASEQYIDTEKKKREKAYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQD   1541 - 1610
TLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTG   1611 - 1680
EVWVRFDLQLFEQKTLL                                                        1681 - 1697
//

Text Mined References (45)

PMID Year Title
26633357 2015 ITSN2L Interacts with and Negatively Regulates RABEP1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23936226 2013 Adaptor proteins intersectin 1 and 2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
23274495 2013 Crystal structure of human Intersectin-2L C2 domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
22449706 2012 Human intersectin 2 (ITSN2) binds to Eps8 protein and enhances its degradation.
More...