Property Summary

NCBI Gene PubMed Count 41
PubMed Score 75.20
PubTator Score 25.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.0
Disease Target Count Z-score Confidence
Muscular dystrophy 75 4.642 2.3
Nonsyndromic deafness 142 3.244 1.6

Expression

  Differential Expression (37)

Disease log2 FC p
active Crohn's disease 1.023 1.2e-02
active ulcerative colitis 1.408 2.6e-03
acute quadriplegic myopathy 1.360 2.6e-05
adult high grade glioma 1.500 9.9e-04
aldosterone-producing adenoma -1.324 3.3e-02
Amyotrophic lateral sclerosis 1.052 9.1e-05
astrocytoma 2.000 4.0e-02
Astrocytoma, Pilocytic 1.800 4.9e-07
atypical teratoid / rhabdoid tumor 2.400 4.9e-03
autosomal dominant Emery-Dreifuss muscul... 1.226 6.1e-03
Becker muscular dystrophy 1.001 1.1e-02
Breast cancer -1.100 2.4e-05
chronic kidney disease 1.500 1.7e-02
dermatomyositis 1.400 4.2e-02
diabetes mellitus -1.100 2.4e-02
Duchenne muscular dystrophy 2.034 7.2e-10
ependymoma 2.100 4.8e-08
fascioscapulohumeral muscular dystrophy 1.145 2.2e-04
glioblastoma 1.600 2.9e-04
intraductal papillary-mucinous adenoma (... 1.500 1.9e-02
intraductal papillary-mucinous carcinoma... 1.400 4.2e-02
intraductal papillary-mucinous neoplasm ... 2.400 1.2e-02
juvenile dermatomyositis 1.827 1.2e-12
limb girdle muscular dystrophy 2A 1.316 6.5e-07
lung adenocarcinoma 1.353 5.8e-04
lung cancer -1.900 1.5e-03
lung carcinoma -2.600 9.4e-38
malignant mesothelioma 1.300 1.2e-06
mucosa-associated lymphoid tissue lympho... 2.141 1.2e-02
osteosarcoma 1.651 2.6e-02
ovarian cancer -1.400 3.6e-09
pancreatic cancer 1.600 2.4e-05
pancreatic ductal adenocarcinoma liver m... 2.931 4.9e-03
pituitary cancer -1.200 1.1e-02
psoriasis -1.300 1.7e-04
subependymal giant cell astrocytoma 3.883 3.6e-03
tuberculosis and treatment for 6 months -1.400 8.7e-03

 GO Function (1)

 CSPA Cell Line (3)

Gene RIF (23)

AA Sequence

MLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVK      1 - 70
DFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSAPHPNDLSGPSV     71 - 140
PGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQ    141 - 210
LSGNNIRPVVKVHVCGQTHRTRIKRGNNPFFDELFFYNVNMTPSELMDEIISIRVYNSHSLRADCLMGEF    211 - 280
KIDVGFVYDEPGHAVMRKWLLLNDPEDTSSGSKGYMKVSMFVLGTGDEPPPERRDRDNDSDDVESNLLLP    281 - 350
AGIALRWVTFLLKIYRAEDIPQMDDAFSQTVKEIFGGNADKKNLVDPFVEVSFAGKKVCTNIIEKNANPE    351 - 420
WNQVVNLQIKFPSVCEKIKLTIYDWDRLTKNDVVGTTYLHLSKIAASGGEVEDFSSSGTGAASYTVNTGE    421 - 490
TEVGFVPTFGPCYLNLYGSPREYTGFPDPYDELNTGKGEGVAYRGRILVELATFLEKTPPDKKLEPISND    491 - 560
DLLVVEKYQRRRKYSLSAVFHSATMLQDVGEAIQFEVSIGNYGNKFDTTCKPLASTTQYSRAVFDGNYYY    561 - 630
YLPWAHTKPVVTLTSYWEDISHRLDAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIE    631 - 700
DTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEIEDWLDKLMQLTEEPQN    701 - 770
SMPDIIIWMIRGEKRLAYARIPAHQVLYSTSGENASGKYCGKTQTIFLKYPQEKNNGPKVPVELRVNIWL    771 - 840
GLSAVEKKFNSFAEGTFTVFAEMYENQALMFGKWGTSGLVGRHKFSDVTGKIKLKREFFLPPKGWEWEGE    841 - 910
WIVDPERSLLTEADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAW    911 - 980
SYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHTHRRRRLVRKRKKDLTQTASSTARAMEELQDQEG    981 - 1050
WEYASLIGWKFHWKQRSSDTFRRRRWRRKMAPSETHGAAAIFKLEGALGADTTEDGDEKSLEKQKHSATT   1051 - 1120
VFGANTPIVSCNFDRVYIYHLRCYVYQARNLLALDKDSFSDPYAHICFLHRSKTTEIIHSTLNPTWDQTI   1121 - 1190
IFDEVEIYGEPQTVLQNPPKVIMELFDNDQVGKDEFLGRSIFSPVVKLNSEMDITPKLLWHPVMNGDKAC   1191 - 1260
GDVLVTAELILRGKDGSNLPILPPQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNFQMASITSPSLV   1261 - 1330
VECGGERVESVVIKNLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIERLDRF   1331 - 1400
RCDPYAGKEDIVPQLKASLLSAPPCRDIVIEMEDTKPLLASKLTEKEEEIVDWWSKFYASSGEHEKCGQY   1401 - 1470
IQKGYSKLKIYNCELENVAEFEGLTDFSDTFKLYRGKSDENEDPSVVGEFKGSFRIYPLPDDPSVPAPPR   1471 - 1540
QFRELPDSVPQECTVRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYELSC   1541 - 1610
YLPQEKDLKISVYDYDTFTRDEKVGETIIDLENRFLSRFGSHCGIPEEYCVSGVNTWRDQLRPTQLLQNV   1611 - 1680
ARFKGFPQPILSEDGSRIRYGGRDYSLDEFEANKILHQHLGAPEERLALHILRTQGLVPEHVETRTLHST   1681 - 1750
FQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDVILDEKSITGEEMSDIYVKGW   1751 - 1820
IPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQLCIVAKKEHFWSIDQTEFRIPPRLIIQIWDN   1821 - 1890
DKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDMIPDLKAMNPLKAKTASLFEQKSMKGWWPCYAEKDGAR   1891 - 1960
VMAGKVEMTLEILNEKEADERPAGKGRDEPNMNPKLDLPNRPETSFLWFTNPCKTMKFIVWRRFKWVIIG   1961 - 2030
LLFLLILLLFVAVLLYSLPNYLSMKIVKPNV                                          2031 - 2061
//

Text Mined References (47)

PMID Year Title