Property Summary

NCBI Gene PubMed Count 42
PubMed Score 11.86
PubTator Score 23.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 1.1e-08
ovarian cancer 8520 4.7e-06
Multiple Sclerosis 540 4.3e-05
Multiple myeloma 1332 2.0e-02
primary Sjogren syndrome 735 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.400 1.1e-08
Multiple myeloma 1.095 2.0e-02
Multiple Sclerosis 1.300 4.3e-05
ovarian cancer -1.700 4.7e-06
primary Sjogren syndrome 1.100 2.7e-02

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQV      1 - 70
NLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVF     71 - 140
DGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKS    141 - 210
ANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPIT    211 - 280
DSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH                    281 - 334
//

Text Mined References (49)

PMID Year Title