Property Summary

NCBI Gene PubMed Count 41
Grant Count 55
R01 Count 24
Funding $5,797,994.32
PubMed Score 10.04
PubTator Score 23.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.095 0.020
Multiple Sclerosis 1.300 0.000
primary Sjogren syndrome 1.100 0.027
lung adenocarcinoma -1.400 0.000
ovarian cancer -1.700 0.000

Gene RIF (17)

PMID Text
25794709 Interaction between MAT2B and GIT1 serves as a scaffold and facilitates signaling in multiple steps of the Ras/Raf/MEK/ERK pathway
25294683 Mutagenesis of MATalpha2 and MATbeta phospho-sites destabilized them and prevented hepatic stellate cell trans-differentiation.
23814050 resveratrol induces HuR, SIRT1, and MAT2B expression; the last may represent a compensatory response against apoptosis and growth inhibition.
23425511 The structure of MAT2B reveals a short-chain dehydrogenase/reductase (SDR) core with specificity for the NADP/H cofactor, and harbors the SDR catalytic triad.
23325601 MAT2B and GIT1 form a scaffold, which recruits and activates MEK and ERK to promote growth and tumorigenesis.
21813468 Coexpression of MAT2A and MAT2B in COS-1 cells resulted in significantly increased MAT enzyme activity.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20421296 Data show MAT2beta variants reside mostly in the nucleus and regulate HuR subcellular content to affect cell proliferation.
More...

AA Sequence

MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQV      1 - 70
NLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVF     71 - 140
DGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKS    141 - 210
ANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPIT    211 - 280
DSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH                    281 - 334
//

Text Mined References (48)

PMID Year Title
25794709 2015 Methionine adenosyltransferase 2B-GIT1 complex serves as a scaffold to regulate Ras/Raf/MEK1/2 activity in human liver and colon cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25294683 2015 Role of methionine adenosyltransferase ?2 and ? phosphorylation and stabilization in human hepatic stellate cell trans-differentiation.
25075345 2014 Structure and function study of the complex that synthesizes S-adenosylmethionine.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
23814050 2013 Methionine adenosyltransferase 2B, HuR, and sirtuin 1 protein cross-talk impacts on the effect of resveratrol on apoptosis and growth in liver cancer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23425511 2013 Insight into S-adenosylmethionine biosynthesis from the crystal structures of the human methionine adenosyltransferase catalytic and regulatory subunits.
23325601 2013 MAT2B-GIT1 interplay activates MEK1/ERK 1 and 2 to induce growth in human liver and colon cancer.
More...