Property Summary

NCBI Gene PubMed Count 34
Grant Count 39
R01 Count 28
Funding $3,293,470.66
PubMed Score 35.88
PubTator Score 28.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
adult high grade glioma 2,148
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.000 0.000
adult high grade glioma -1.100 0.001

Gene RIF (19)

PMID Text
26538602 our results clearly show that HspBP1 acts as an endogenous negative regulator of HIV-1 gene-expression and replication by suppressing NF-kappaB-mediated activation of viral transcription.
24898092 Oxidative stress, inducing formation of disulfide bond, can affect stability and conformational mobility of human HspB1.
24454860 BAG-1M and HspBP1 had differential impacts on the dynamic composition of steroid receptor folding complexes
22037021 shown that HspBP1 binds Tag7 in the conditioned medium of tumor CSML0 cells, thereby preventing formation of the cytotoxic Tag7-Hsp70 complex
20694586 High gene expression of HspBP1 is associated with leukemia.
19659607 HspBP1 may play a role in tumor (dys)regulation of chaperone proteins
19183265 Our data suggest that HIP may prevent inclusion formation by facilitating the constitutive HSC70 refolding cycle and possibly by preventing aggregation.
18987994 Results indicate that low HspBP1 expression could be a marker of tumor aggressiveness.
18986301 The two chaperones, HSP72 and HSPBP1, interact both physically and functionally, leading to the activation of th EGFR-ERK1/2 signalling pathway.
18261988 Association between endogenous LAP2alpha and Hsp70 in non-transfected cells was confirmed by co-immunoprecipitation.
More...

AA Sequence

MSDEGSRGSRLPLALPPASQGCSSGGGGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPM      1 - 70
SEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNA     71 - 140
ADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVK    141 - 210
ALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL    211 - 280
VALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT    281 - 350
CFSSPADDSMDR                                                              351 - 362
//

Text Mined References (40)

PMID Year Title
26538602 2016 HSP70 binding protein 1 (HspBP1) suppresses HIV-1 replication by inhibiting NF-?B mediated activation of viral gene expression.
25416956 2014 A proteome-scale map of the human interactome network.
24898092 2014 Effect of disulfide crosslinking on thermal transitions and chaperone-like activity of human small heat shock protein HspB1.
24454860 2014 Hsp70 cochaperones HspBP1 and BAG-1M differentially regulate steroid hormone receptor function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22037021 2012 Extracellular HspBP1 inhibits formation of a cytotoxic Tag7-Hsp70 complex in vitro and in human serum.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20694586 2011 Heat-shock protein expression in leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...