Property Summary

NCBI Gene PubMed Count 37
PubMed Score 38.87
PubTator Score 28.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.2e-04
adult high grade glioma 3801 9.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Long Qt Syndrome 2 5 3.141 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 9.9e-04
psoriasis 2.000 1.2e-04

Gene RIF (19)

AA Sequence

MSDEGSRGSRLPLALPPASQGCSSGGGGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPM      1 - 70
SEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNA     71 - 140
ADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVK    141 - 210
ALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL    211 - 280
VALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT    281 - 350
CFSSPADDSMDR                                                              351 - 362
//

Text Mined References (43)

PMID Year Title