Property Summary

NCBI Gene PubMed Count 24
Grant Count 1
Funding $10,662
PubMed Score 166.90
PubTator Score 14.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NZL3 A6NFW9 P17033 Q86V10 Q8IZC8 Q9UID9 Q9Y2P6
Symbols BMZF2
KOX22
ZNF27
BMZF-2
ZNF233
ZNF255

Gene

 Grant Application (1)

PDB

2ELY   2ELZ   2EM0   2EM6   2EM7   2EM8   2EM9   2EN1   2EN8   2ENA   2ENC   2EOQ   2EOR   2EQ4   2YSP   2YTH  

Gene RIF (12)

PMID Text
26320177 Data show that Wilms' tumor 1 protein (WT1)binds to the zinc finger protein 224 (ZNF224) promoter and represses ZNF224 expression.
23362234 ZNF224 acts in fine tuning of WT1-dependent control of gene expression, acting as a co-activator of WT1 in the regulation of proapoptotic genes and suppressing WT1 mediated transactivation of antiapoptotitc genes.
21187159 REVIEW: ZNF224 is a multifunctional protein and alternative splicing, sub-cellular compartmentalization and isoform-specific interactions may modulate its activity
20591825 ZNF224 acts as a transcriptional co-regulator of WT1.
20587513 Coimmunoprecipitation and immunocytochemistry revealed that DEPDC1 interacted and colocalized with zinc finger transcription factor ZNF224, a known transcriptional repressor.
20574532 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19741270 ZNF224 recruits the arginine methyltransferase PRMT5 on the transcriptional repressor complex of the aldolase A gene
19505435 CIC silencer activity extends over 26 bp (-595/-569), which specifically bind a protein ZNF224 present in HepG2 cell nuclear extracts.
17900823 Differential expression and cellular localization of ZNF224 and ZNF255, two isoforms of the Kruppel-like zinc-finger protein family.
More...

AA Sequence

MTTFKEAMTFKDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQAFHRDTFHFLREEKIWMMKT      1 - 70
AIQREGNSGDKIQTEMETVSEAGTHQEWSFQQIWEKIASDLTRSQDLMINSSQFSKEGDFPCQTEAGLSV     71 - 140
IHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGEKSHTCDECGKNFCYISALRIHQRVHMGEKCYKCDVCG    141 - 210
KEFSQSSHLQTHQRVHTGEKPFKCVECGKGFSRRSALNVHHKLHTGEKPYNCEECGKAFIHDSQLQEHQR    211 - 280
IHTGEKPFKCDICGKSFCGRSRLNRHSMVHTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPYKCEECG    281 - 350
KGFICRRDLYTHHMVHTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPFKCEECGKGFYTNSQCYSHQR    351 - 420
SHSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLYNCKECGKSFSRAPCLLKHERLHSGEKPFQCEECG    421 - 490
KRFTQNSHLHSHQRVHTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPYNCKECGKSFGWASCLLKHQR    491 - 560
LHSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPYKCDECGKGFSWSSTRLTHQRRHSRETPLKCEQHG    561 - 630
KNIVQNSFSKVQEKVHSVEKPYKCEDCGKGYNRRLNLDMHQRVHMGEKTWKCRECDMCFSQASSLRLHQN    631 - 700
VHVGEKP                                                                   701 - 707
//

Text Mined References (25)

PMID Year Title
27105517 2016 ZNF224, Krüppel like zinc finger protein, induces cell growth and apoptosis-resistance by down-regulation of p21 and p53 via miR-663a.
26563595 2016 The hematopoietic tumor suppressor interferon regulatory factor 8 (IRF8) is upregulated by the antimetabolite cytarabine in leukemic cells involving the zinc finger protein ZNF224, acting as a cofactor of the Wilms' tumor gene 1 (WT1) protein.
26320177 2015 WT1-mediated repression of the proapoptotic transcription factor ZNF224 is triggered by the BCR-ABL oncogene.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
23362234 2013 Role of WT1-ZNF224 interaction in the expression of apoptosis-regulating genes.
21187159 2011 ZNF224: Structure and role of a multifunctional KRAB-ZFP protein.
20591825 2010 Biochemical and functional interaction between ZNF224 and ZNF255, two members of the Kruppel-like zinc-finger protein family and WT1 protein isoforms.
20587513 2010 Cell-permeable peptide DEPDC1-ZNF224 interferes with transcriptional repression and oncogenicity in bladder cancer cells.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...