Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.09
PubTator Score 1.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00120510546912484
psoriasis 6685 0.00125779404118014

Synonym

Accession Q9NZK7 Q5VXJ8 GIIE sPLA2
Symbols sPLA2-IIE
GIIE sPLA2

Gene

PANTHER Protein Class (3)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
25755141 sPLA(2) -IIE regulates lipolysis in adipocytes, likely through the ERK/HSL signaling pathway
25132377 expression of PLA2s-IIE and -V correlates with the development of calcification as well as the expression of pro-osteogenic molecules in human aortic valves
23511034 Single-nucleotide polymorphism in PLA2G2E gene is associated with ulcerative colitis.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11922621 promotes stimulus-induced arachidonic acid release and prostaglandin (PG) production similar to those elicited by HSPG-dependent sPLA(2)s, suggesting that this enzyme plays a role in the inflammatory process.
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYG      1 - 70
RLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTP     71 - 140
PC                                                                        141 - 142
//

Text Mined References (10)

PMID Year Title
25755141 2015 Group IIE secretory phospholipase A2 regulates lipolysis in adipocytes.
25132377 2014 The expression of groups IIE and V phospholipase A2 is associated with an increased expression of osteogenic molecules in human calcified aortic valves.
23511034 2013 Genome-wide association study of ulcerative colitis in Koreans suggests extensive overlapping of genetic susceptibility with Caucasians.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10681567 2000 Structures, enzymatic properties, and expression of novel human and mouse secretory phospholipase A(2)s.