Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.09
PubTator Score 1.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Synonym

Accession Q9NZK7 Q5VXJ8 GIIE sPLA2
Symbols sPLA2-IIE
GIIE sPLA2

Gene

PANTHER Protein Class (3)

Gene RIF (8)

PMID Text
25755141 sPLA(2) -IIE regulates lipolysis in adipocytes, likely through the ERK/HSL signaling pathway
25132377 expression of PLA2s-IIE and -V correlates with the development of calcification as well as the expression of pro-osteogenic molecules in human aortic valves
23511034 Single-nucleotide polymorphism in PLA2G2E gene is associated with ulcerative colitis.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11922621 promotes stimulus-induced arachidonic acid release and prostaglandin (PG) production similar to those elicited by HSPG-dependent sPLA(2)s, suggesting that this enzyme plays a role in the inflammatory process.
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYG      1 - 70
RLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTP     71 - 140
PC                                                                        141 - 142
//

Text Mined References (10)

PMID Year Title
25755141 2015 Group IIE secretory phospholipase A2 regulates lipolysis in adipocytes.
25132377 2014 The expression of groups IIE and V phospholipase A2 is associated with an increased expression of osteogenic molecules in human calcified aortic valves.
23511034 2013 Genome-wide association study of ulcerative colitis in Koreans suggests extensive overlapping of genetic susceptibility with Caucasians.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10681567 2000 Structures, enzymatic properties, and expression of novel human and mouse secretory phospholipase A(2)s.