Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.37
PubTator Score 71.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 2.900 0.000
astrocytic glioma -2.800 0.011
ependymoma -2.800 0.022
oligodendroglioma -2.400 0.024
psoriasis -2.700 0.000
osteosarcoma -1.919 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
primitive neuroectodermal tumor -1.200 0.029
lung cancer 2.100 0.000
pediatric high grade glioma -1.300 0.000
group 4 medulloblastoma 1.200 0.046
pilocytic astrocytoma -1.300 0.000
aldosterone-producing adenoma -1.043 0.029

Synonym

Accession Q9NZJ9 B7Z916 Q4AEJ6 Q53EZ2 Q68DD7 Q9NPC5 Q9NS30 Q9NZK0 Q9NZK1 DIPP-2
Symbols DIPP2
HDCMB47P
DIPP2beta
DIPP2alpha

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
18976975 Knockdown of nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
10777568 This paper demonstrates that KIAA0487 (AB007956) is the 3'-UTR for human diphosphoinositol polyphosphate phosphohydrolase type II

AA Sequence

MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEE      1 - 70
AGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYL     71 - 140
EKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR                                  141 - 180
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370170 2002 Nudix hydrolases that degrade dinucleoside and diphosphoinositol polyphosphates also have 5-phosphoribosyl 1-pyrophosphate (PRPP) pyrophosphatase activity that generates the glycolytic activator ribose 1,5-bisphosphate.
12121577 2002 Cloning and characterisation of hAps1 and hAps2, human diadenosine polyphosphate-metabolising Nudix hydrolases.
More...