Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.55
PubTator Score 71.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.300 5.1e-03
aldosterone-producing adenoma -1.017 2.4e-02
astrocytic glioma -2.800 1.1e-02
Astrocytoma, Pilocytic -1.300 2.2e-04
atypical teratoid / rhabdoid tumor -1.100 1.0e-02
ependymoma -2.800 2.2e-02
glioblastoma -1.200 1.4e-05
group 4 medulloblastoma 1.200 4.6e-02
lung cancer 2.100 9.8e-06
malignant mesothelioma 2.900 4.8e-09
oligodendroglioma -2.400 2.4e-02
osteosarcoma -1.101 3.8e-04
primitive neuroectodermal tumor -1.200 2.9e-02
psoriasis -2.700 1.4e-05

Gene RIF (2)

AA Sequence

MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEE      1 - 70
AGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYL     71 - 140
EKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR                                  141 - 180
//

Text Mined References (14)

PMID Year Title