Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.07
PubTator Score 7.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.1e-05
dermatomyositis 966 2.1e-04

Expression

  Differential Expression (2)

Disease log2 FC p
dermatomyositis 1.100 2.1e-04
medulloblastoma, large-cell -1.600 1.1e-05

Gene RIF (11)

AA Sequence

MGASDPEVAPWARGGAAGMAGAGAGAGARGGAAAGVEARARDPPPAHRAHPRHPRPAAQPSARRMDGGSG      1 - 70
GLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTNVLGRKVLYLPSFFTYAKYIV     71 - 140
QVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQCVSRM    141 - 210
LAHPLHVISMRCMVQFVGREAKYSGVLSSIGKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAY    211 - 280
LVDDSVSDTPGGLGNDQNPGSQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYS    281 - 350
PVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFALE                                   351 - 389
//

Text Mined References (24)

PMID Year Title