Property Summary

NCBI Gene PubMed Count 9
PubMed Score 21.24
PubTator Score 4.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung cancer 2890 1.8e-12
astrocytic glioma 2597 4.1e-03
acute myeloid leukemia 783 8.8e-03
ependymoma 4679 9.4e-03

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.400 8.8e-03
astrocytic glioma -1.100 4.1e-03
ependymoma -1.100 9.4e-03
non-small cell lung cancer 1.270 1.8e-12

Gene RIF (2)

AA Sequence

MWSGRKLGSSGGWFLRVLGPGGCNTKAARPLISSAVYVKNQLSGTLQIKPGVFNEYRTIWFKSYRTIFSC      1 - 70
LNRIKSFRYPWARLYSTSQTTVDSGEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQ     71 - 140
PGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPVDENIKTAQCHKSFDPVLDKRIEYRVCSLEEIVE    141 - 210
ETAETFDAVVASEVVEHVIDLETFLQCCCQVLKPGGSLFITTINKTQLSYALGIVFSEQIASIVPKGTHT    211 - 280
WEKFVSPETLESILESNGLSVQTVVGMLYNPFSGYWHWSENTSLNYAAYAVKSRVQEHPASAEFVLKGET    281 - 350
EELQANACTNPAVHEKLKK                                                       351 - 369
//

Text Mined References (12)

PMID Year Title