Property Summary

NCBI Gene PubMed Count 49
PubMed Score 49.96
PubTator Score 46.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 3.432 1.6e-06
adult high grade glioma 3.000 1.9e-04
astrocytoma 1.200 1.9e-07
Atopic dermatitis 1.200 2.8e-04
atypical teratoid / rhabdoid tumor 3.300 1.2e-09
Breast cancer 3.200 4.3e-27
breast carcinoma 2.300 1.3e-48
colon cancer 2.200 4.5e-05
ductal carcinoma in situ 3.400 1.4e-03
Endometriosis 1.871 4.0e-02
ependymoma 1.800 1.1e-04
esophageal adenocarcinoma 1.600 1.8e-02
glioblastoma 3.800 2.9e-11
group 3 medulloblastoma 5.100 7.4e-10
interstitial cystitis 2.300 2.5e-04
intraductal papillary-mucinous carcinoma... 2.800 2.6e-04
intraductal papillary-mucinous neoplasm ... 3.200 1.8e-03
invasive ductal carcinoma 3.500 4.6e-04
lung adenocarcinoma 1.100 2.6e-07
lung cancer 1.100 1.9e-03
malignant mesothelioma 1.600 8.6e-07
medulloblastoma, large-cell 4.400 1.2e-07
nasopharyngeal carcinoma 2.300 3.5e-07
non-small cell lung cancer 2.085 7.9e-15
oligodendroglioma 1.600 3.6e-07
ovarian cancer 2.300 1.8e-07
pancreatic cancer 1.600 8.8e-05
pituitary cancer 1.100 1.2e-02
primitive neuroectodermal tumor 4.200 2.1e-06
psoriasis 1.500 4.3e-09

 GWAS Trait (2)

Gene RIF (38)

AA Sequence

MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVA      1 - 70
NEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQ     71 - 140
CSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLA    141 - 210
PSVDFQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILD    211 - 280
STGSTLFANCTDDNIYMFNMTGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPW    281 - 350
QPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGGDKLSTVGWASQKKKESRPGL    351 - 420
VTVTSSQSTPAKAPRAKCNPSNSSPSSAACAPSCAGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVS    421 - 490
PKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQAEACSESRNRVKRRLDSSCL    491 - 560
ESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSKDSLGPTKSSKIEGAGTSISEPPSPISPYAS    561 - 630
ESCGTLPLPLRPCGEGSEMVGKENSSPENKNWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKKLPSPVT    631 - 700
ITPSSMRKICTYFHRKSQEDFCGPEHSTEL                                            701 - 730
//

Text Mined References (63)

PMID Year Title