Property Summary

NCBI Gene PubMed Count 48
Grant Count 26
R01 Count 4
Funding $934,266.99
PubMed Score 45.31
PubTator Score 46.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
25483090 These findings reveal C/EBPalpha regulates G1/S cell cycle arrest in response to DNA damage via the control of CRL4(Cdt2) mediated degradation of p21.
25483071 CDT2 mediated XPG elimination from DNA damage sites clears the chromatin space needed for repair.
25411249 CDK1 activity blocks CRL4CDT2 by preventing chromatin recruitment of the substrate receptor, CDT2.
25154416 Data shows that phosphorylation of Cdt2 at T464 is important fot its interaction with Cdt2.
25115388 CDT2 likely is a non-oncogene to which transformed cells become addicted because of their enhanced cellular stress, such as replicative stress and DNA damage.
24962565 CRL4(Cdt2)-dependent degradation of TDG occurs in S phase because of the requirement for TDG to interact with chromatin-loaded PCNA, and this degradation is important for preventing toxicity from excess TDG.
24699724 while interaction with PCNA was important for targeting p21 to the CRL4Cdt2 ligase re-localized to MVM replication centers
24022480 ubiquitination of p12 through CRL4(Cdt2) and subsequent degradation form one mechanism by which a cell responds to DNA damage to inhibit fork progression.
23995842 Data indicate that depleting ubiquitin E3 ligase CRL4(CDT2/DCAF2) mimicked the pharmacological effects of MLN4924.
23913683 Data indicate that CRL4(Cdt2) regulates the degradation of the p12 subunit of Pol delta4.
More...

AA Sequence

MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVA      1 - 70
NEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQ     71 - 140
CSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLA    141 - 210
PSVDFQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILD    211 - 280
STGSTLFANCTDDNIYMFNMTGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPW    281 - 350
QPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGGDKLSTVGWASQKKKESRPGL    351 - 420
VTVTSSQSTPAKAPRAKCNPSNSSPSSAACAPSCAGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVS    421 - 490
PKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQAEACSESRNRVKRRLDSSCL    491 - 560
ESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSKDSLGPTKSSKIEGAGTSISEPPSPISPYAS    561 - 630
ESCGTLPLPLRPCGEGSEMVGKENSSPENKNWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKKLPSPVT    631 - 700
ITPSSMRKICTYFHRKSQEDFCGPEHSTEL                                            701 - 730
//

Text Mined References (61)

PMID Year Title
25483090 2014 C/EBP? regulates CRL4(Cdt2)-mediated degradation of p21 in response to UVB-induced DNA damage to control the G1/S checkpoint.
25483071 2015 Cdt2-mediated XPG degradation promotes gap-filling DNA synthesis in nucleotide excision repair.
25411249 2015 CDK1-dependent inhibition of the E3 ubiquitin ligase CRL4CDT2 ensures robust transition from S Phase to Mitosis.
25154416 2014 14-3-3 proteins play a role in the cell cycle by shielding cdt2 from ubiquitin-mediated degradation.
25115388 2014 The stress phenotype makes cancer cells addicted to CDT2, a substrate receptor of the CRL4 ubiquitin ligase.
24962565 2014 CRL4Cdt2 E3 ubiquitin ligase and proliferating cell nuclear antigen (PCNA) cooperate to degrade thymine DNA glycosylase in S phase.
24699724 2014 Efficient parvovirus replication requires CRL4Cdt2-targeted depletion of p21 to prevent its inhibitory interaction with PCNA.
24022480 2013 Degradation of p12 subunit by CRL4Cdt2 E3 ligase inhibits fork progression after DNA damage.
23995842 2013 Ubiquitin E3 ligase CRL4(CDT2/DCAF2) as a potential chemotherapeutic target for ovarian surface epithelial cancer.
23913683 2013 A novel function of CRL4(Cdt2): regulation of the subunit structure of DNA polymerase ? in response to DNA damage and during the S phase.
More...