Property Summary

NCBI Gene PubMed Count 84
Grant Count 83
R01 Count 47
Funding $6,763,187.49
PubMed Score 68.90
PubTator Score 170.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.208 1.6
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 2.293 0.016

Synonym

Accession Q9NZI8 C9JT33 IGF2 mRNA-binding protein 1
Symbols IMP1
ZBP1
CRDBP
IMP-1
CRD-BP
VICKZ1

Gene

PDB

3KRM  

Gene RIF (69)

PMID Text
26852652 ETV6/RUNX1 transcript is a target of RNA-binding protein IGF2BP1 in t(12;21)(p13;q22)-positive acute lymphoblastic leukemia.
26547929 Data show that ONECUT2, IGF2BP1, and ANXA2 proteins were confirmed to be microRNA-9 (miR-9) targets and aberrantly upregulated in hepatocellular carcinoma (HCC).
26194191 The tumor-suppressive role of stromal IMP1 and its ability to modulate protumorigenic factors suggest that IMP1 status is important for the initiation and growth of epithelial tumors
26160756 Data show that insulin-like growth factor-2-mRNA-binding proteins IGF2BP1, IGF2BP2, and IGF2BP3 are direct targets of microRNA-1275 (miR-1275).
25889892 IGF2BP1 as a direct and functional target of miR-196b.
25861986 High CRD-BP expression is associated with Breast Tumor.
25753434 Data demonstrate that IGF2BP1 is a potential oncogene and an independent negative prognostic factor in neuroblastoma.
25749978 Gag-IMP1 interaction requires the second zinc finger of the NC domain (residues 390-449) of Gag and the KH3 (residues 409-458) and KH4 (residues 490-540) domains of IMP1
25670861 miR-873 negatively affected the carcinogenesis and metastasis of GBM by down-regulating the expression of IGF2BP1, which stabilizes the mRNA transcripts of its target genes
25414259 MicroRNA-340-mediated degradation of MITF mRNA is inhibited by CRD-BP.
More...

AA Sequence

MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEI      1 - 70
EHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLN     71 - 140
GHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAI    141 - 210
IGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLK    211 - 280
ILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREA    281 - 350
YENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI    351 - 420
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLET    421 - 490
HIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQV    491 - 560
KQQHQKGQSNQAQARRK                                                         561 - 577
//

Text Mined References (93)

PMID Year Title
26852652 2016 ETV6/RUNX1 transcript is a target of RNA-binding protein IGF2BP1 in t(12;21)(p13;q22)-positive acute lymphoblastic leukemia.
26547929 2015 Comprehensive profiling of novel microRNA-9 targets and a tumor suppressor role of microRNA-9 via targeting IGF2BP1 in hepatocellular carcinoma.
26194191 2015 Loss of Stromal IMP1 Promotes a Tumorigenic Microenvironment in the Colon.
26160756 2015 miR-1275: A single microRNA that targets the three IGF2-mRNA-binding proteins hindering tumor growth in hepatocellular carcinoma.
25889892 2015 miRNA-196b inhibits cell proliferation and induces apoptosis in HepG2 cells by targeting IGF2BP1.
25861986 2015 Two Isoforms of the RNA Binding Protein, Coding Region Determinant-binding Protein (CRD-BP/IGF2BP1), Are Expressed in Breast Epithelium and Support Clonogenic Growth of Breast Tumor Cells.
25753434 2015 IGF2BP1 harbors prognostic significance by gene gain and diverse expression in neuroblastoma.
25670861 2015 MicroRNA-873 (miRNA-873) inhibits glioblastoma tumorigenesis and metastasis by suppressing the expression of IGF2BP1.
25414259 2015 MicroRNA-340-mediated degradation of microphthalmia-associated transcription factor (MITF) mRNA is inhibited by coding region determinant-binding protein (CRD-BP).
25389298 2015 Molecular insights into the coding region determinant-binding protein-RNA interaction through site-directed mutagenesis in the heterogeneous nuclear ribonucleoprotein-K-homology domains.
More...