Property Summary

NCBI Gene PubMed Count 12
Grant Count 31
R01 Count 20
Funding $1,568,054.1
PubMed Score 48.41
PubTator Score 13.72

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.031 0.000
juvenile dermatomyositis 1.258 0.000
breast carcinoma 1.200 0.001
ovarian cancer 1.500 0.007

Gene RIF (6)

PMID Text
19751393 Data revealed that dimers composed of LBP-1a and LBP-1c were re-formed probably by a partner-exchange of LBP-1b-containing heterodimers.
19662162 UBP1 is a critical blood pressure determinant using a combination of mouse and human genetics.
18004979 LBP-1b and LBP-9 both stimulate LBP-32/MGR promoter activity.
15471945 LBP-1b is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of LBP-1b, exerting both positive and negative effects
15207707 Combination of LBP-1 and Oct1 cellular transcription activators represses transcription initiation at the HIV-1 LTR promoter by HIV-1 Tat
7836461 Combination of LBP-1 and Oct1 cellular transcription activators represses transcription initiation at the HIV-1 LTR promoter by HIV-1 Tat

AA Sequence

MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQYVMCA      1 - 70
ATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWN     71 - 140
RPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQV    141 - 210
DTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPII    211 - 280
EDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDAPTAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPN    281 - 350
HQGDGASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNS    351 - 420
LKSRSVRPRLTIYVCREQPSSTVLQGQQQAASSASENGSGAPYVYHAIYLEEMIASEVARKLALVFNIPL    421 - 490
HQINQVYRQGPTGIHILVSDQMVQNFQDESCFLFSTVKAESSDGIHIILK                        491 - 540
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19751393 2009 Transactivation activity of LBP-1 proteins and their dimerization in living cells.
19662162 2009 Identification of the UBP1 locus as a critical blood pressure determinant using a combination of mouse and human genetics.
18004979 2008 LBP-1b, LBP-9, and LBP-32/MGR detected in syncytiotrophoblasts from first-trimester human placental tissue and their transcriptional regulation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471945 2005 LBP proteins modulate SF1-independent expression of P450scc in human placental JEG-3 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...