Property Summary

NCBI Gene PubMed Count 12
PubMed Score 48.41
PubTator Score 13.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 9.17176508811718E-12
osteosarcoma 7933 4.06681381683204E-4
breast carcinoma 1614 5.58021183542725E-4
ovarian cancer 8492 0.00667065452195913

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.031 0.000
juvenile dermatomyositis 1.258 0.000
breast carcinoma 1.200 0.001
ovarian cancer 1.500 0.007

Synonym

Accession Q9NZI7 Q68CT0 Q86Y57 Q9H8V0 Q9UD76 Q9UD78
Symbols LBP1A
LBP1B
LBP-1B
LBP-1a

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA Inparanoid

Pathway (1)

Gene RIF (6)

PMID Text
19751393 Data revealed that dimers composed of LBP-1a and LBP-1c were re-formed probably by a partner-exchange of LBP-1b-containing heterodimers.
19662162 UBP1 is a critical blood pressure determinant using a combination of mouse and human genetics.
18004979 LBP-1b and LBP-9 both stimulate LBP-32/MGR promoter activity.
15471945 LBP-1b is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of LBP-1b, exerting both positive and negative effects
15207707 Combination of LBP-1 and Oct1 cellular transcription activators represses transcription initiation at the HIV-1 LTR promoter by HIV-1 Tat
7836461 Combination of LBP-1 and Oct1 cellular transcription activators represses transcription initiation at the HIV-1 LTR promoter by HIV-1 Tat

AA Sequence

MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQYVMCA      1 - 70
ATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWN     71 - 140
RPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQV    141 - 210
DTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPII    211 - 280
EDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDAPTAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPN    281 - 350
HQGDGASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNS    351 - 420
LKSRSVRPRLTIYVCREQPSSTVLQGQQQAASSASENGSGAPYVYHAIYLEEMIASEVARKLALVFNIPL    421 - 490
HQINQVYRQGPTGIHILVSDQMVQNFQDESCFLFSTVKAESSDGIHIILK                        491 - 540
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19751393 2009 Transactivation activity of LBP-1 proteins and their dimerization in living cells.
19662162 2009 Identification of the UBP1 locus as a critical blood pressure determinant using a combination of mouse and human genetics.
18004979 2008 LBP-1b, LBP-9, and LBP-32/MGR detected in syncytiotrophoblasts from first-trimester human placental tissue and their transcriptional regulation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471945 2005 LBP proteins modulate SF1-independent expression of P450scc in human placental JEG-3 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...