Property Summary

NCBI Gene PubMed Count 11
Grant Count 3
Funding $64,320
PubMed Score 9.48
PubTator Score 8.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9NZI6 Q4ZG43
Symbols LBP9
CRTR1
LBP-9

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
20661472 Study show that CRTR-1 is generally an activator of transcription and that it modulates the activity of other family members, CP2, NF2d9 and altNF2d9, in a cell specific manner.
18004979 LBP-1b and LBP-9 both stimulate LBP-32/MGR promoter activity.
15471945 LBP-1b is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of LBP-1b, exerting both positive and negative effects

AA Sequence

MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYLN      1 - 70
QGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEHQQLEGWRWSRPGDRILDIDIPLSVGI     71 - 140
LDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHS    141 - 210
ASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPN    211 - 280
SFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQIC    281 - 350
GPADGIRLFNAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIAN    351 - 420
LYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL               421 - 479
//

Text Mined References (11)

PMID Year Title
23001997 2012 Identification of a susceptibility locus in STAT4 for Behçet's disease in Han Chinese in a genome-wide association study.
20661472 2010 Modulation of CP2 family transcriptional activity by CRTR-1 and sumoylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18004979 2008 LBP-1b, LBP-9, and LBP-32/MGR detected in syncytiotrophoblasts from first-trimester human placental tissue and their transcriptional regulation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471945 2005 LBP proteins modulate SF1-independent expression of P450scc in human placental JEG-3 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11073954 2001 CRTR-1, a developmentally regulated transcriptional repressor related to the CP2 family of transcription factors.
10644752 2000 Cloning of factors related to HIV-inducible LBP proteins that regulate steroidogenic factor-1-independent human placental transcription of the cholesterol side-chain cleavage enzyme, P450scc.
More...