Property Summary

NCBI Gene PubMed Count 20
PubMed Score 30.63
PubTator Score 18.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis 2.551 4.6e-02
adult high grade glioma -1.200 6.8e-04
Astrocytoma, Pilocytic -1.200 3.4e-03
Breast cancer -1.200 1.2e-06
cystic fibrosis -1.393 6.0e-05
interstitial cystitis -1.300 5.6e-03
intraductal papillary-mucinous neoplasm ... 3.100 5.6e-03
medulloblastoma, large-cell -1.600 2.0e-04
nasopharyngeal carcinoma -1.400 3.2e-02
non-small cell lung cancer 1.181 3.4e-08
ovarian cancer 1.200 1.7e-02
pancreatic cancer 1.300 3.1e-02
pancreatic carcinoma 1.300 3.1e-02
pancreatic ductal adenocarcinoma liver m... -1.090 2.1e-02
posterior fossa group A ependymoma -1.200 1.7e-05
psoriasis 1.100 7.4e-04
sonic hedgehog group medulloblastoma -1.300 2.0e-04
spina bifida -2.294 3.6e-02

Gene RIF (9)

AA Sequence

MTQEYDNKRPVLVLQNEALYPQRRSYTSEDEAWKSFLENPLTAATKAMMSINGDEDSAAALGLLYDYYKV      1 - 70
PRERRSSTAKPEVEHPEPDHSKRNSIPIVTEQPLISAGENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTA     71 - 140
PDTTVTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPD    141 - 210
STFSETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNKGQFY    211 - 280
PITLKEVSSSEGIHHPISKVRSVIMVVFAEDKSREDQLRHWKYWHSRQHTAKQRCIDIADYKESFNTISN    281 - 350
IEEIAYNAISFTWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQVDTYSYNNRSNKPVHRAYCQIKVF    351 - 420
CDKGAERKIRDEERKQSKRKVSDVKVPLLPSHKRMDITVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLP    421 - 490
IASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGLMEAI    491 - 560
SDKYDVPHDKIGKIFKKCKKGILVNMDDNIVKHYSNEDTFQLQIEEAGGSYKLTLTEI                561 - 618
//

Text Mined References (22)

PMID Year Title