Property Summary

NCBI Gene PubMed Count 18
PubMed Score 28.88
PubTator Score 18.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NZI5 A6NLA4 B2R7E4 B5MEC2 Q53T93 Q6NWN7 Q6NWN8 Q6NWN9 Q8NI33
Symbols MGR
NH32
LBP32
TFCP2L2

Gene

PANTHER Protein Class (1)

Gene RIF (7)

PMID Text
26069269 GRHL1, GRHL2, and GRHL3 have roles in cellular proliferation, differentiation, adhesion, and polarity and may promote cancer or be tumor suppressors [review]
25896282 Grhl1 deficiency affects inner ear development in zebrafish.
25406394 Downregulation of miR122 by grainyhead-like 2 restricts the hepatocytic differentiation potential of adult liver progenitor cells.
24419085 A significant role for HDAC3 in the MYCN-mediated repression of GRHL1.
24375798 Our findings reveal important pathophysiological differences between human pulmonary fibrosis and specific mouse models of fibrosis and support a crucial role of GRHL2 in epithelial activation in lung fibrosis and perhaps also in epithelial plasticity.
18004979 LBP-1b and LBP-9 both stimulate LBP-32/MGR promoter activity.
12393799 Includes a comparison to TFCP2L2, the GRHL1 protein.

AA Sequence

MTQEYDNKRPVLVLQNEALYPQRRSYTSEDEAWKSFLENPLTAATKAMMSINGDEDSAAALGLLYDYYKV      1 - 70
PRERRSSTAKPEVEHPEPDHSKRNSIPIVTEQPLISAGENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTA     71 - 140
PDTTVTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPD    141 - 210
STFSETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNKGQFY    211 - 280
PITLKEVSSSEGIHHPISKVRSVIMVVFAEDKSREDQLRHWKYWHSRQHTAKQRCIDIADYKESFNTISN    281 - 350
IEEIAYNAISFTWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQVDTYSYNNRSNKPVHRAYCQIKVF    351 - 420
CDKGAERKIRDEERKQSKRKVSDVKVPLLPSHKRMDITVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLP    421 - 490
IASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGLMEAI    491 - 560
SDKYDVPHDKIGKIFKKCKKGILVNMDDNIVKHYSNEDTFQLQIEEAGGSYKLTLTEI                561 - 618
//

Text Mined References (20)

PMID Year Title
26069269 2015 Recent discoveries concerning the involvement of transcription factors from the Grainyhead-like family in cancer.
25896282 2015 Grhl1 deficiency affects inner ear development in zebrafish.
25406394 2014 Downregulation of miR122 by grainyhead-like 2 restricts the hepatocytic differentiation potential of adult liver progenitor cells.
24419085 2014 GRHL1 acts as tumor suppressor in neuroblastoma and is negatively regulated by MYCN and HDAC3.
24375798 2014 Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21081122 2011 The unique and cooperative roles of the Grainy head-like transcription factors in epidermal development reflect unexpected target gene specificity.
18288204 2008 Perturbed desmosomal cadherin expression in grainy head-like 1-null mice.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...