Property Summary

NCBI Gene PubMed Count 31
Grant Count 5
Funding $657,802.94
PubMed Score 31.37
PubTator Score 31.22

Knowledge Summary

Patent (2,535)

Expression

  Differential Expression (7)

Gene RIF (11)

PMID Text
26831368 These studies showed that a common copy number variation in KCNIP1 gene is a genetic predictor of atrial fibrillation risk possibly pointing to a functional pathway.
24886904 KCNIP1 from copy number variations study might function as a type 2 diabetes susceptibility gene whose dysregulation alters insulin production.
24792378 V234I-VAPB induces ubiquitin aggregation followed by cell death; proposed that V234I-VAPB exhibits the characteristics of amyotrophic lateral sclerosis in spite of not having the typical aggregation property of different mutations in various neurodegenerative diseases
24681403 Protein aggregation due to nsSNP resulting in P56S VABP protein is associated with amyotrophic lateral sclerosis
21129448 our findings suggest that KChIP1 interacts with Kv4.3 in interneurons at the stratum lacunosum-moleculare/radiatum junction
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19550036 EF-hands 3 and 4 of KChIP1 are functionally involved in a specific association with PS on the membrane
18393943 These results reveal a new role for KChIP3 in the regulation of calcium regulated secretion and also suggest that the functions of each of the KChIPs may be more specialized than previously appreciated.
17057713 X-ray crystallographic and small-angle X-ray scattering data that show that the KChIP1-Kv4.3 N-terminal cytoplasmic domain complex is a cross-shaped octamer bearing two principal interaction sites.
15358149 Data show that KChIP1, KChIP2.1, and KChIP2.2 could form homo- as well as hetero-oligomers, and that this oligomerization did not perturb their interaction with Kv4.2 potassium channel.

AA Sequence

MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRG      1 - 70
FKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRW     71 - 140
TFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESC    141 - 210
QEDDNIMRSLQLFQNVM                                                         211 - 227
//

Text Mined References (33)

PMID Year Title
26831368 2016 Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24886904 2014 Genome-wide copy number variation study reveals KCNIP1 as a modulator of insulin secretion.
24792378 2014 First evidence of pathogenicity of V234I mutation of hVAPB found in Amyotrophic Lateral Sclerosis.
24681403 2014 Protein aggregation due to nsSNP resulting in P56S VABP protein is associated with amyotrophic lateral sclerosis.
22612322 2012 Subcellular localization and transcription regulatory potency of KCNIP/Calsenilin/DREAM/KChIP proteins in cultured primary cortical neurons do not provide support for their role in CRE-dependent gene expression.
22020049 2012 Molecular structure and target recognition of neuronal calcium sensor proteins.
21129448 2011 KChIP1 modulation of Kv4.3-mediated A-type K(+) currents and repetitive firing in hippocampal interneurons.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19550036 2009 Functional role of EF-hands 3 and 4 in membrane-binding of KChIP1.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18415675 2008 Modulation by clamping: Kv4 and KChIP interactions.
18393943 2008 Specific effects of KChIP3/calsenilin/DREAM, but not KChIPs 1, 2 and 4, on calcium signalling and regulated secretion in PC12 cells.
17187064 2007 Structural basis for modulation of Kv4 K+ channels by auxiliary KChIP subunits.
17057713 2006 Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer.
16260497 2005 Traffic of Kv4 K+ channels mediated by KChIP1 is via a novel post-ER vesicular pathway.
16112838 2005 Structure, alternative splicing, and expression of the human and mouse KCNIP gene family.
15968430 2005 Experimental study on the new significant function domains of KCHIP1 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15358149 2004 Protein-protein interactions of KChIP proteins and Kv4.2.
15184042 2004 Evidence showing an intermolecular interaction between KChIP proteins and Taiwan cobra cardiotoxins.
14980207 2004 Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14572458 2003 Differential modulation of Kv4 kinetics by KCHIP1 splice variants.
12829703 2003 A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
11976919 2002 Functional interaction between KChIP1 and GFP-fused Kv4.3L co-expressed in HEK293 cells.
11423117 2001 Different effects of the Ca(2+)-binding protein, KChIP1, on two Kv4 subfamily members, Kv4.1 and Kv4.2.
11287421 2001 Conserved Kv4 N-terminal domain critical for effects of Kv channel-interacting protein 2.2 on channel expression and gating.
10676964 2000 Modulation of A-type potassium channels by a family of calcium sensors.