Property Summary

NCBI Gene PubMed Count 32
PubMed Score 33.12
PubTator Score 31.22

Knowledge Summary

Patent (2,535)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.7
Disease Target Count Z-score Confidence
Pneumonia 174 3.532 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 1.9e-03
atypical teratoid / rhabdoid tumor -1.400 3.4e-03
ependymoma -1.600 7.7e-06
group 3 medulloblastoma -1.600 6.6e-03
medulloblastoma, large-cell -1.700 2.5e-02
Pick disease -1.100 1.2e-03
subependymal giant cell astrocytoma -1.243 2.7e-02

Gene RIF (12)

AA Sequence

MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRG      1 - 70
FKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRW     71 - 140
TFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESC    141 - 210
QEDDNIMRSLQLFQNVM                                                         211 - 227
//

Text Mined References (34)

PMID Year Title