Property Summary

NCBI Gene PubMed Count 37
Grant Count 13
R01 Count 1
Funding $580,875.84
PubMed Score 8.05
PubTator Score 9.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Barrett's esophagus 1.700 0.025
psoriasis 5.600 0.000
cutaneous lupus erythematosus 2.300 0.002
tuberculosis -1.100 0.001
non-small cell lung cancer 1.641 0.000
cystic fibrosis 2.300 0.000
spina bifida -1.884 0.023

Gene RIF (24)

PMID Text
26819203 IRF6 is likely to promote inflammation to P. gingivalis through its regulation of IL-36gamma.
26562662 Findings indicate that Interleukin (IL)-1beta-induced interleukin 36 gamma (IL-36gamma) expression is mediated by the activation of transcriptional factors, NF-kappaB p65 and AP-1 (c-jun).
26516833 Study shows that plasma concentrations of IL-36alpha and IL-36gamma are overexpressed in active systemic lupus erythematosus patients and that IL-36alpha has a substantial pro-inflammatory effect through regulation of IL-6 and CXCL8 production.
26321222 IL-36gamma expression inversely correlated with the progression of human melanoma and lung cancer.
25897967 IL36G was identified as strong regulators of skin pathology in both lesional and non-lesional skin samples.
25525775 IL-36gamma is a valuable biomarker in psoriasis patients, both for diagnostic purposes and measurement of disease activity during the clinical course
25305315 CAMP induces IL-36gamma expression leading to initiation of skin inflammation and occasional exacerbations of psoriasis.
24950037 Decreased Langerhans cell responses to IL36G: altered innate immunity in patients with recurrent respiratory papillomatosis
24829417 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of interleukin 36, gamma (IL36G) expression as compared to untreated control
More...

AA Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQG      1 - 70
RGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFI     71 - 140
ASSKRDQPIILTSELGKSYNTAFELNIND                                             141 - 169
//

Text Mined References (38)

PMID Year Title
26819203 2016 IRF6 Regulates the Expression of IL-36? by Human Oral Epithelial Cells in Response to Porphyromonas gingivalis.
26562662 2015 Interleukin (IL)-1? Is a Strong Inducer of IL-36? Expression in Human Colonic Myofibroblasts.
26516833 2015 Elevated Expression and Pro-Inflammatory Activity of IL-36 in Patients with Systemic Lupus Erythematosus.
26321222 2015 IL-36? Transforms the Tumor Microenvironment and Promotes Type 1 Lymphocyte-Mediated Antitumor Immune Responses.
25897967 2015 Transcriptional landscape of psoriasis identifies the involvement of IL36 and IL36RN.
25525775 2015 IL-36? (IL-1F9) is a biomarker for psoriasis skin lesions.
25305315 2014 Alarmin function of cathelicidin antimicrobial peptide LL37 through IL-36? induction in human epidermal keratinocytes.
24950037 2014 Decreased Langerhans cell responses to IL-36?: altered innate immunity in patients with recurrent respiratory papillomatosis.
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
23147407 2013 The IL-36 receptor pathway regulates Aspergillus fumigatus-induced Th1 and Th17 responses.
More...