Property Summary

NCBI Gene PubMed Count 42
PubMed Score 9.95
PubTator Score 9.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 5.500 1.2e-18
Barrett's esophagus 1.700 2.5e-02
cutaneous lupus erythematosus 2.300 1.9e-03
cystic fibrosis 2.000 5.0e-06
non-small cell lung cancer 1.641 1.6e-05
spina bifida -1.884 2.3e-02
tuberculosis -1.100 1.2e-03

Gene RIF (29)

AA Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQG      1 - 70
RGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFI     71 - 140
ASSKRDQPIILTSELGKSYNTAFELNIND                                             141 - 169
//

Text Mined References (43)

PMID Year Title