Property Summary

NCBI Gene PubMed Count 37
PubMed Score 8.05
PubTator Score 9.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.59578425453392E-5
cystic fibrosis 1670 4.49552459683085E-4
tuberculosis 1563 0.00117782587603879
cutaneous lupus erythematosus 1056 0.00187732925371787
spina bifida 1064 0.023490066253687
Barrett's esophagus 185 0.0248140872226793
Disease Target Count Z-score Confidence
psoriasis 6685 3.808 1.9

Expression

  Differential Expression (7)

Disease log2 FC p
Barrett's esophagus 1.700 0.025
psoriasis 5.600 0.000
cutaneous lupus erythematosus 2.300 0.002
tuberculosis -1.100 0.001
non-small cell lung cancer 1.641 0.000
cystic fibrosis 2.300 0.000
spina bifida -1.884 0.023

Synonym

Accession Q9NZH8 Q56B91 Q6UVX7 Q7RTZ9
Symbols IL1E
IL1F9
IL1H1
IL-1F9
IL-1H1
IL1RP2
IL-1RP2

Gene

PDB

4IZE   4P0J   4P0K   4P0L  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid

Gene RIF (24)

PMID Text
26819203 IRF6 is likely to promote inflammation to P. gingivalis through its regulation of IL-36gamma.
26562662 Findings indicate that Interleukin (IL)-1beta-induced interleukin 36 gamma (IL-36gamma) expression is mediated by the activation of transcriptional factors, NF-kappaB p65 and AP-1 (c-jun).
26516833 Study shows that plasma concentrations of IL-36alpha and IL-36gamma are overexpressed in active systemic lupus erythematosus patients and that IL-36alpha has a substantial pro-inflammatory effect through regulation of IL-6 and CXCL8 production.
26321222 IL-36gamma expression inversely correlated with the progression of human melanoma and lung cancer.
25897967 IL36G was identified as strong regulators of skin pathology in both lesional and non-lesional skin samples.
25525775 IL-36gamma is a valuable biomarker in psoriasis patients, both for diagnostic purposes and measurement of disease activity during the clinical course
25305315 CAMP induces IL-36gamma expression leading to initiation of skin inflammation and occasional exacerbations of psoriasis.
24950037 Decreased Langerhans cell responses to IL36G: altered innate immunity in patients with recurrent respiratory papillomatosis
24829417 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of interleukin 36, gamma (IL36G) expression as compared to untreated control
More...

AA Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQG      1 - 70
RGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFI     71 - 140
ASSKRDQPIILTSELGKSYNTAFELNIND                                             141 - 169
//

Text Mined References (38)

PMID Year Title
26819203 2016 IRF6 Regulates the Expression of IL-36? by Human Oral Epithelial Cells in Response to Porphyromonas gingivalis.
26562662 2015 Interleukin (IL)-1? Is a Strong Inducer of IL-36? Expression in Human Colonic Myofibroblasts.
26516833 2015 Elevated Expression and Pro-Inflammatory Activity of IL-36 in Patients with Systemic Lupus Erythematosus.
26321222 2015 IL-36? Transforms the Tumor Microenvironment and Promotes Type 1 Lymphocyte-Mediated Antitumor Immune Responses.
25897967 2015 Transcriptional landscape of psoriasis identifies the involvement of IL36 and IL36RN.
25525775 2015 IL-36? (IL-1F9) is a biomarker for psoriasis skin lesions.
25305315 2014 Alarmin function of cathelicidin antimicrobial peptide LL37 through IL-36? induction in human epidermal keratinocytes.
24950037 2014 Decreased Langerhans cell responses to IL-36?: altered innate immunity in patients with recurrent respiratory papillomatosis.
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
23147407 2013 The IL-36 receptor pathway regulates Aspergillus fumigatus-induced Th1 and Th17 responses.
More...