Property Summary

NCBI Gene PubMed Count 79
Grant Count 28
R01 Count 15
Funding $3,271,804.92
PubMed Score 109.75
PubTator Score 209.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -3.000 0.000
Atopic dermatitis -4.800 0.000
lung adenocarcinoma 1.700 0.003

Gene RIF (59)

PMID Text
26791086 Findings show IL-37 mRNA and protein expressions significantly decreased in non-small cell lung cancer and demonstrate its protective role possibly through inhibiting tumor angiogenesis.
26561030 these data suggest a special role for IL-37 in asthma pathogenesis
26547368 The results suggest serum IL-37 levels were increased in rheumatoid arthritis (RA) patients and were positively associated with disease activity, IL-17/IL-23 and bone loss in RA, suggesting that IL-37 may play a critical role in the pathogenesis of RA.
26515414 Suggest that IL-37 is a novel and potent proangiogenic cytokine.
26464282 The expression of IL-37 was decreased in renal cell carcinoma patients and was negatively correlated with tumor progression.
26454413 IL-37 is an important cytokine in the control of asthma by suppressing the production of inflammatory cytokines.
26411375 These results demonstrated that IL-37 might manifest as a critical protein involving in immunosuppression of human CD4(+)CD25(+)Tregs.
26373794 Our study strongly supports that the IL37 gene variants are associated with the susceptibility to AITD.
26319074 Letter: Expression of IL-37 is decreased in psoriatic skin.
26253248 Interleukin-37 expression is decreased in Behcet's disease and is associated with inflammation
More...

AA Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVL      1 - 70
VLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKL     71 - 140
MKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAE    141 - 210
MSPSEVSD                                                                  211 - 218
//

Text Mined References (80)

PMID Year Title
26791086 2016 Interleukin-37 suppresses tumor growth through inhibition of angiogenesis in non-small cell lung cancer.
26561030 2015 Allergic airway inflammation: unravelling the relationship between IL-37, IL-18R? and Tir8/SIGIRR.
26547368 2015 Elevated serum levels of Interleukin-37 are associated with inflammatory cytokines and disease activity in rheumatoid arthritis.
26515414 2015 IL-37 Is a Novel Proangiogenic Factor of Developmental and Pathological Angiogenesis.
26464282 2015 IL-37 mediates the antitumor activity in renal cell carcinoma.
26454413 2016 Anti-inflammatory activity of IL-37 in asthmatic children: Correlation with inflammatory cytokines TNF-?, IL-?, IL-6 and IL-17A.
26411375 2015 Expression of IL-37 contributes to the immunosuppressive property of human CD4+CD25+ regulatory T cells.
26373794 2015 Polymorphism of IL37 gene as a protective factor for autoimmune thyroid disease.
26319074 2015 Expression of IL-36 family cytokines and IL-37 but not IL-38 is altered in psoriatic skin.
26253248 2015 Interleukin-37 expression is decreased in Behçet's disease and is associated with inflammation.
More...