Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.76
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.500 0.000
inflammatory breast cancer 2.200 0.000
lung adenocarcinoma 1.900 0.000
psoriasis -1.300 0.006

Gene RIF (2)

PMID Text
26617803 PTTG2 induces psoriasis by regulating epidermal expression of vimentin and E-cadherin.
23470537 Knockdown of PTTG2 results in concomitant downregulation of E-cadherin and elevated vimentin levels, consistent with epithelial-to-mesenchymal transition.

AA Sequence

MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKATRKALGTVNRA      1 - 70
TEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPFNLLDFESFDLPEERQIAHLP     71 - 140
LSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLLQSPSSILSTLDVELPAVCYDIDI            141 - 202
//

Text Mined References (9)

PMID Year Title
26617803 2015 Pituitary tumor transforming gene PTTG2 induces psoriasis by regulating vimentin and E-cadherin expression.
23470537 2013 PTTG2 silencing results in induction of epithelial-to-mesenchymal transition and apoptosis.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10806349 2000 Identification of the human pituitary tumor transforming gene (hPTTG) family: molecular structure, expression, and chromosomal localization.
10084610 1999 An intronless homolog of human proto-oncogene hPTTG is expressed in pituitary tumors: evidence for hPTTG family.