Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MATLIYVDKENEEPGILVATKDGLKLGSGPSIKALDGRSQVSISCFGKTFDAPTSLPKATRKALGTVNRA      1 - 70
TEKSVKTNGPLKQKQPSFSAKKMTEKTVKAKNSVPASDDGYPEIEKLFPFNPLGFESFDLPEEHQIAHLP     71 - 140
LSEVPLMILDEERELEKLFQLGPPSPLKMPSPPWKSNLLQSPLSILLTLDVELPPVCSDIDI            141 - 202
//

Text Mined References (3)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16201836 2005 Emergence of young human genes after a burst of retroposition in primates.
10806349 2000 Identification of the human pituitary tumor transforming gene (hPTTG) family: molecular structure, expression, and chromosomal localization.