Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.4e-05
Breast cancer 1.100 2.5e-04
colon cancer -1.100 1.7e-02
glioblastoma 1.400 1.2e-04
medulloblastoma, large-cell 1.500 3.2e-05
ovarian cancer 1.500 6.4e-07
pediatric high grade glioma 1.100 5.8e-05
primitive neuroectodermal tumor 1.300 2.0e-04
psoriasis 1.800 6.0e-05

AA Sequence

MATLIYVDKENEEPGILVATKDGLKLGSGPSIKALDGRSQVSISCFGKTFDAPTSLPKATRKALGTVNRA      1 - 70
TEKSVKTNGPLKQKQPSFSAKKMTEKTVKAKNSVPASDDGYPEIEKLFPFNPLGFESFDLPEEHQIAHLP     71 - 140
LSEVPLMILDEERELEKLFQLGPPSPLKMPSPPWKSNLLQSPLSILLTLDVELPPVCSDIDI            141 - 202
//

Text Mined References (3)

PMID Year Title