Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.40
PubTator Score 25.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 3.800 0.000
psoriasis -1.100 0.003
oligodendroglioma -1.100 0.000
osteosarcoma -1.876 0.001
ependymoma -1.300 0.000
group 4 medulloblastoma -1.600 0.002
medulloblastoma, large-cell -1.200 0.027
tuberculosis 1.800 0.000
non-small cell lung cancer -1.671 0.000
lung cancer -2.100 0.000
interstitial cystitis 1.500 0.000
atypical teratoid/rhabdoid tumor -1.400 0.001
subependymal giant cell astrocytoma -2.378 0.003
Pick disease -1.200 0.019
progressive supranuclear palsy -1.300 0.032
Breast cancer 1.200 0.000
gastric carcinoma 1.300 0.030
ovarian cancer 1.500 0.002
Down syndrome 1.100 0.003

Gene RIF (12)

PMID Text
24959832 Data shows that common and rare variants in the NINJ2 region were nominally associated with incident ischemic stroke patients.
24664524 Risk of ischemic stroke was higher especially when the carriers of rs11833579 AA NINJ2 genotype were smokers.
22795341 This meta-analysis suggest that rs12425791 is relative to ischemic stroke risk under dominant model in Asian population, but not for rs11833579.
22429733 Data suggest that the gene NINJ2 rs11833579 A/A or G/A genotype may bring forward the onset age of first-ever ischemic stroke without increasing silent cerebrovascular lesions prior to the stroke.
22297388 In this meta-analysis, NINJ2 single-nucleotide polymorphism (SNP) rs12425791 is significantly associated with ischemic stroke in an East Asian (but not Chinese Han) population, of which A alleles increase the risk of ischemic stroke.
21722921 A new genetic variant rs10849373 located in the first intron of the NINJ2 gene confers risk of ischemic stroke in Chinese Han subjects.
21674003 polymorphisms of the vascular susceptibility gene NINJ2 were associated with risk of Alzheimer's disease
21376321 12p13 SNPs rs11833579 and rs12425791 within NINJ2 gene do not seem to be associated with ischemic stroke in Chinese Han population
20957003 There is a significant association between rs11833579 site polymorphism of the NINJ2 gene and risk for stroke in Han Chinese.
20957003 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSSHYYTTLVTLI      1 - 70
SLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINVFITAFGAHKTGFLAARASRN     71 - 140
PL                                                                        141 - 142
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24959832 2014 Associations of NINJ2 sequence variants with incident ischemic stroke in the Cohorts for Heart and Aging in Genomic Epidemiology (CHARGE) consortium.
24664524 2014 Association between NINJ2 gene polymorphisms and ischemic stroke: a family-based case-control study.
22795341 2012 The rs11833579 and rs12425791 polymorphisms and risk of ischemic stroke in an Asian population: a meta-analysis.
22429733 2012 NINJ2 SNP may affect the onset age of first-ever ischemic stroke without increasing silent cerebrovascular lesions.
22297388 2012 Association between 12p13 SNPs rs11833579/rs12425791 near NINJ2 gene and ischemic stroke in East Asian population: evidence from a meta-analysis.
21722921 2011 NINJ2 polymorphism is associated with ischemic stroke in Chinese Han population.
21674003 2011 Genetic polymorphisms of a novel vascular susceptibility gene, Ninjurin2 (NINJ2), are associated with a decreased risk of Alzheimer's disease.
21376321 2011 No evidence for association of 12p13 SNPs rs11833579 and rs12425791 within NINJ2 gene with ischemic stroke in Chinese Han population.
20957003 2010 [Strong association between the NINJ2 gene polymorphism and the susceptibility of stroke in Chinese Han population in Fangshan district].
More...