Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.93
PubTator Score 25.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.400 1.1e-03
Breast cancer 1.200 9.5e-05
Down syndrome 1.100 2.9e-03
ependymoma -1.300 3.3e-06
gastric carcinoma 1.300 3.0e-02
group 3 medulloblastoma -1.400 4.4e-02
interstitial cystitis 1.400 2.0e-03
lung cancer -1.600 1.7e-03
malignant mesothelioma 3.800 1.4e-07
medulloblastoma, large-cell -1.200 2.7e-02
non-small cell lung cancer -1.671 3.0e-10
oligodendroglioma -1.100 3.9e-06
osteosarcoma -1.876 8.4e-04
ovarian cancer 1.500 1.9e-03
Pick disease -1.200 1.9e-02
progressive supranuclear palsy -1.300 3.2e-02
psoriasis -1.100 3.2e-03
subependymal giant cell astrocytoma -2.378 3.1e-03
tuberculosis 1.800 1.7e-07

Synonym

Accession Q9NZG7
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

AA Sequence

MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSSHYYTTLVTLI      1 - 70
SLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINVFITAFGAHKTGFLAARASRN     71 - 140
PL                                                                        141 - 142
//

Text Mined References (18)

PMID Year Title