Property Summary

NCBI Gene PubMed Count 12
Grant Count 8
R01 Count 8
Funding $2,323,793.6
PubMed Score 58.82
PubTator Score 376.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26669866 Results establish PLAC8 as a central mediator of tumor progression in PDAC.
25720387 Methylation status of 17 CpG sites in PLAC8 negatively correlated with mRNA expression
24794439 Plac8 provides a mechanistic link between primary oncogenic mutations and the induction of autophagy, a central mechanism of metabolic reprogramming, during PDA progression.
24691442 Excess PLAC8 promotes an unconventional ERK2-dependent EMT in colon cancer.
23708710 expression of retinol-binding protein 4 (RBP4) and placenta-specific 8 increased in the bone tumors of PC3-GFP/PC3-OPG-injected mice. Knockdown of both RBP4 and PLAC8 by siRNA inhibited the growth of PC-3 cells in vitro.
22920440 Data suggest that overexpression of PLAC8 induces apoptosis in some cells (CEM-C7 cells; Jurkat T cells); expression of PLAC8 has anti-apoptosis effect in other cells (adherent cell lines; HEK293T cells; MCF-10A cells).
20072156 phorbol 12-myristate 13-acetate(PMA)downregulates onzin expression through PKCepsilon-ERK2 signaling pathway, which favors monocytic differentiation of leukemic cells.

AA Sequence

MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAM      1 - 70
RTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF                              71 - 115
//

Text Mined References (12)

PMID Year Title
26669866 2016 PLAC8 Localizes to the Inner Plasma Membrane of Pancreatic Cancer Cells and Regulates Cell Growth and Disease Progression through Critical Cell-Cycle Regulatory Pathways.
25720387 2015 Epigenetic Regulation of Placenta-Specific 8 Contributes to Altered Function of Endothelial Colony-Forming Cells Exposed to Intrauterine Gestational Diabetes Mellitus.
24794439 2014 Plac8 links oncogenic mutations to regulation of autophagy and is critical to pancreatic cancer progression.
24691442 2014 Excess PLAC8 promotes an unconventional ERK2-dependent EMT in colon cancer.
23708710 2013 Induction of retinol-binding protein 4 and placenta-specific 8 expression in human prostate cancer cells remaining in bone following osteolytic tumor growth inhibition by osteoprotegerin.
22920440 2013 Apoptosis suppression by candidate oncogene PLAC8 is reversed in other cell types.
20072156 2010 The downregulation of onzin expression by PKCepsilon-ERK2 signaling and its potential role in AML cell differentiation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
12758124 2003 Plac8 and Plac9, novel placental-enriched genes identified through microarray analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...