Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (1)

AA Sequence

MAASAFAGAVRAASGILRPLNILASSTYRNCVKNASLISALSTGRFSHIQTPVVSSTPRLTTSERNLTCG      1 - 70
HTSVILNRMAPVLPSVLKLPVRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPAR     71 - 140
KKRLREFVFCNKTQSKLLDKMTTSFWKRRNWYVDDPYQKYHDRTNLKV                          141 - 188
//

Text Mined References (16)

PMID Year Title