Property Summary

NCBI Gene PubMed Count 17
Grant Count 205
R01 Count 86
Funding $27,200,878.84
PubMed Score 11.03
PubTator Score 51.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.634 0.000
glioblastoma 1.300 0.001
tuberculosis 1.100 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q9NZD8 B4DW44 Q6ZMB6
Symbols MAST
ACP33
GL010
BM-019

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
21205478 HBV X gene enhanced SPG21 gene promoter activity, SPG21 mRNA expression and SPG21 protein production in HepG2 cells in a dose-dependent manner.
19184135 Data report that maspardin localizes prominently to cytoplasm as well as to membranes, possibly at trans-Golgi network/late endosomal compartments, and that maspardin interacts with the aldehyde dehydrogenase ALDH16A1.
14564668 frameshift results in the premature termination of the encoded product, which is designated "maspardin" (Mast syndrome, spastic paraplegia, autosomal recessive with dementia)

AA Sequence

MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWG      1 - 70
YRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDT     71 - 140
SIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVE    141 - 210
PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTK    211 - 280
YAAIDPSMVSAEELEVQKGSLGISQEEQ                                              281 - 308
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21205478 2010 [Effect of hepatitis B virus X gene on the expression of spastic paraplegia 21].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19184135 2009 Interaction of the SPG21 protein ACP33/maspardin with the aldehyde dehydrogenase ALDH16A1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...