Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.39
PubTator Score 51.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 1.8e-08
glioblastoma 1.300 5.1e-04
Multiple myeloma 1.634 1.4e-04
ovarian cancer -1.200 2.8e-05
tuberculosis 1.100 6.3e-07

Gene RIF (3)

AA Sequence

MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWG      1 - 70
YRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDT     71 - 140
SIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVE    141 - 210
PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTK    211 - 280
YAAIDPSMVSAEELEVQKGSLGISQEEQ                                              281 - 308
//

Text Mined References (21)

PMID Year Title