Property Summary

NCBI Gene PubMed Count 41
Grant Count 42
R01 Count 34
Funding $7,388,239.21
PubMed Score 96.49
PubTator Score 595.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -5.898 0.000
tuberculosis 1.100 0.044
mucosa-associated lymphoid tissue lympho... 3.884 0.009
acute myeloid leukemia -1.500 0.023
psoriasis -2.500 0.000

Gene RIF (33)

PMID Text
26460260 AHSP expression was higher in patients with sickle cell anemia versus thalassemia, with no significant difference between BTM and BTI. Expression was higher in patients with NTDT and on hydroxyurea therapy.
25648458 In maturing RBC progenitors AHSP bind to free alpha-globin chains to increase the HbA production. (Review)
25611244 AHSP is predominantly expressed in erythroid precursors in bone marrow biopsy specimens from patients with hematologic malignancies.
24795058 The relationship between AHSP gene expression, disease severity, and the beta/alpha globin mRNA ratio was studied among different homozygote beta-thalassemia patients.
24740453 analysis showed binding of STAT3 to AHSP promoter and binding was significantly augmented with IL6 stimulation and upon alpha-globin overexpression
23696640 alpha-Hemoglobin-stabilizing protein (AHSP) perturbs the proximal heme pocket of oxy-alpha-hemoglobin and weakens the iron-oxygen bond.
23333304 HIV-1 Vif upregulates the expression of alpha hemoglobin stabilizing protein (AHSP) in Vif-expression T cells
23264625 alpha-Hemoglobin stabilizing protein (AHSP) markedly decreases the redox potential and reactivity of alpha-subunits of human HbA with hydrogen peroxide.
22298770 AHSP acts as a molecular chaperone by rapidly binding and stabilizing met-alpha hemichrome folding intermediates
22079025 AHSP could be a secondary compensatory mechanism in red blood cells to counterbalance the excess of alpha-globin chains in HbE/beta-thalassaemia individuals.
More...

AA Sequence

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL      1 - 70
RQELNTLANPFLAKYRDFLKSHELPSHPPPSS                                           71 - 102
//

Text Mined References (43)

PMID Year Title
26460260 2015 Study of alpha hemoglobin stabilizing protein expression in patients with ? thalassemia and sickle cell anemia and its impact on clinical severity.
25648458 2015 Review: Beta-thalassemia and molecular chaperones.
25611244 2016 ?-Hemoglobin-stabilizing Protein: An Effective Marker for Erythroid Precursors in Bone Marrow Biopsy Specimens.
25416956 2014 A proteome-scale map of the human interactome network.
24795058 2014 Relationship between AHSP gene expression, ?/? globin mRNA ratio, and clinical severity of the ?-thalassemia patients.
24740453 2014 Activation of STAT3 stimulates AHSP expression in K562 cells.
23696640 2013 ?-Hemoglobin-stabilizing protein (AHSP) perturbs the proximal heme pocket of oxy-?-hemoglobin and weakens the iron-oxygen bond.
23264625 2013 ?-Hemoglobin stabilizing protein (AHSP) markedly decreases the redox potential and reactivity of ?-subunits of human HbA with hydrogen peroxide.
22298770 2012 Kinetics of ?-globin binding to ?-hemoglobin stabilizing protein (AHSP) indicate preferential stabilization of hemichrome folding intermediate.
22079025 2012 ?-Haemoglobin stabilising protein expression is influenced by mean cell haemoglobin and HbF levels in HbE/?-thalassaemia individuals.
More...