Property Summary

NCBI Gene PubMed Count 44
PubMed Score 105.51
PubTator Score 595.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.500 2.3e-02
mucosa-associated lymphoid tissue lympho... 3.884 9.3e-03
osteosarcoma -5.898 2.7e-06
psoriasis -2.500 2.9e-17
tuberculosis 1.100 4.4e-02

Gene RIF (35)

AA Sequence

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL      1 - 70
RQELNTLANPFLAKYRDFLKSHELPSHPPPSS                                           71 - 102
//

Text Mined References (46)

PMID Year Title