Property Summary

NCBI Gene PubMed Count 29
PubMed Score 84.38
PubTator Score 46.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.200 1.1e-03
group 4 medulloblastoma -1.200 6.2e-03
interstitial cystitis -1.200 8.6e-06
psoriasis 1.100 9.4e-15
spina bifida -1.800 3.5e-02
ulcerative colitis -1.200 5.4e-08

Synonym

Accession Q9NZD2 Q53Z13 Q96J68 GLTP
Symbols

Gene

PANTHER Protein Class (1)

PDB

1SWX   1SX6   2EUK   2EUM   2EVD   2EVL   2EVS   2EVT   3RIC   3RWV   3RZN   3S0I   3S0K   4GH0   4GHP   4GHS   4GIX   4GJQ   4GVT   4GXD   4GXG   4H2Z  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (20)

AA Sequence

MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTL      1 - 70
QNILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYH     71 - 140
GWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV     141 - 209
//

Text Mined References (31)

PMID Year Title