Property Summary

NCBI Gene PubMed Count 27
Grant Count 23
R01 Count 21
Funding $3,238,186.81
PubMed Score 78.18
PubTator Score 46.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.200 0.001
interstitial cystitis -1.200 0.000
group 4 medulloblastoma -1.200 0.006
psoriasis 1.500 0.000
spina bifida -1.800 0.035
ulcerative colitis -1.200 0.000

Gene RIF (19)

PMID Text
24824606 GLTP not only could be a significant player in cellular sphingolipid metabolism, but also could have a much broader role in the overall lipid metabolism.
23555818 GLTP mediates non-vesicular transport of ganglioside GM1 between native membranes
23519669 Comprehensive analysis of the dimerization interfaces discloses -helices 6 and 2 and the protein C-terminus (C-end) as three specific structural elements that are simultaneously involved in dimer formation and ligand binding by GLTP.
21625605 findings represent the first known phenotypic changes triggered by GLTP overexpression and regulated by direct interaction with a p120-catenin protein family member
20974858 This study represents the first characterization of any Gltp gene promoter and links human GLTP expression to sphingolipid homeostasis through ceramide
20959104 remarkable versatility for Trp, providing three distinct intramolecular functions in the novel amphitropic GLTP fold
19665998 GLTP and VAP-A were shown to interact.
19270338 Glycolipid acquisition by human glycolipid transfer protein dramatically alters intrinsic tryptophan fluorescence: insights into glycolipid binding affinity.
18657186 transgenic expression in Arabidopsis thaliana of human GLTP partially suppressed the phenotype of the acd11 null mutant, resulting in delayed programmed cell death development and plant survival
18261224 Active transcription was found for 12q24.11 GLTP but 11p15.1 GLTP was transcriptionally silent.
More...

AA Sequence

MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTL      1 - 70
QNILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYH     71 - 140
GWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV     141 - 209
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24824606 2014 Alternation in the glycolipid transfer protein expression causes changes in the cellular lipidome.
23555818 2013 GLTP mediated non-vesicular GM1 transport between native membranes.
23519669 2013 Structural insights into lipid-dependent reversible dimerization of human GLTP.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21625605 2011 Human glycolipid transfer protein (GLTP) expression modulates cell shape.
21269460 2011 Initial characterization of the human central proteome.
20974858 2011 Human glycolipid transfer protein gene (GLTP) expression is regulated by Sp1 and Sp3: involvement of the bioactive sphingolipid ceramide.
20959104 2010 Human GLTP: Three distinct functions for the three tryptophans in a novel peripheral amphitropic fold.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
More...