Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.41
PubTator Score 8.03

Knowledge Summary

Patent (2,550)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.300 2.3e-03
ovarian cancer 1.300 9.8e-12
psoriasis -1.100 1.3e-06
Waldenstrons macroglobulinemia -1.054 4.8e-02

Gene RIF (3)

AA Sequence

MYKDCIESTGDYFLLCDAEGPWGIILESLAILGIVVTILLLLAFLFLMRKIQDCSQWNVLPTQLLFLLSV      1 - 70
LGLFGLAFAFIIELNQQTAPVRYFLFGVLFALCFSCLLAHASNLVKLVRGCVSFSWTTILCIAIGCSLLQ     71 - 140
IIIATEYVTLIMTRGMMFVNMTPCQLNVDFVVLLVYVLFLMALTFFVSKATFCGPCENWKQHGRLIFITV    141 - 210
LFSIIIWVVWISMLLRGNPQFQRQPQWDDPVVCIALVTNAWVFLLLYIVPELCILYRSCRQECPLQGNAC    211 - 280
PVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV         281 - 345
//

Text Mined References (7)

PMID Year Title