Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.16
PubTator Score 8.03

Knowledge Summary

Patent (2,550)

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.054 0.048
lung cancer -2.000 0.000
ovarian cancer 1.300 0.000
psoriasis -1.100 0.000

Gene RIF (3)

PMID Text
23510526 GPRC5D in MM cells makes this gene and its encoded surface protein as promising markers for monitoring the tumor load and hopefully also as targets for antimyeloma antibodies.
22591013 Overexpression of G protein-coupled receptor 5D in the bone marrow is associated with poor prognosis in patients with multiple myeloma.
20424473 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYKDCIESTGDYFLLCDAEGPWGIILESLAILGIVVTILLLLAFLFLMRKIQDCSQWNVLPTQLLFLLSV      1 - 70
LGLFGLAFAFIIELNQQTAPVRYFLFGVLFALCFSCLLAHASNLVKLVRGCVSFSWTTILCIAIGCSLLQ     71 - 140
IIIATEYVTLIMTRGMMFVNMTPCQLNVDFVVLLVYVLFLMALTFFVSKATFCGPCENWKQHGRLIFITV    141 - 210
LFSIIIWVVWISMLLRGNPQFQRQPQWDDPVVCIALVTNAWVFLLLYIVPELCILYRSCRQECPLQGNAC    211 - 280
PVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV         281 - 345
//

Text Mined References (7)

PMID Year Title
23510526 2013 GPRC5D is a promising marker for monitoring the tumor load and to target multiple myeloma cells.
22591013 2012 Overexpression of G protein-coupled receptor 5D in the bone marrow is associated with poor prognosis in patients with multiple myeloma.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11311935 2001 Cloning and characterization of a human orphan family C G-protein coupled receptor GPRC5D.