Property Summary

NCBI Gene PubMed Count 200
Grant Count 137
R01 Count 48
Funding $25,457,424.42
PubMed Score 2916.04
PubTator Score 254.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q9NZC7 A8K323 Q5MYT5 Q96KM3 Q96RF2 Q9BTT8 Q9NPC9 Q9NRF4 Q9NRF5 Q9NRF6 Q9NRK1 Q9NZC5
Symbols FOR
WOX1
EIEE28
FRA16D
SCAR12
HHCMA56
PRO0128
SDR41C1
D16S432E

Gene

PANTHER Protein Class (2)

PDB

1WMV  

Gene RIF (177)

PMID Text
26857392 Decreased WWOX expression may interfere with gemcitabine sensitivity, and allele-specific binding at rs11644332 might be a causative molecular mechanism behind the clinically observed associations.
26592150 Data suggest that Pc2- (polycomb repressive complex 2-) mediated SUMOylation of WWOX is essential for suppressive activity of WWOX in prostate cancer tumorigenesis.
26499798 WWOX played roles in metabolic regulation and controlling central nervous system development. [review]
26345274 WWOX mutation is associated with early infantile epileptic encephalopathy.
26166818 overexpression of WWOX attenuated miR-134 induced H69 small cell lung cancer cell growth, and promoted cell apoptosis
26120275 Compared to the controls, upregulation of WWOX and its Tyr33 phosphorylation was observed in the head region of all pterygium specimens. In the head and body of the pterygium specimens, WWOX expression was significantly higher than in the controls.
26041563 HGF and TGFbeta1 of bone-metastasis microenvironment acted co-ordinately, influencing non redundant pathways regulated by Twist program or Snail-transcription factor, with reversible MET switch
25892250 Results suggest that WWOX gene plays a role in the regulation of epithelial to mesenchymal transition process in endometrial cancer by controlling the expression of proteins associated with cell motility and suppressing mesenchymal markers.
25891642 The WWOX gene can downregulate the expression levels of cell cycle proteins cyclin E-CDK2 and cyclin D1-CDK4, which affects the cell cycle of ovarian cancer stem cells.
25720522 Hypermethylation of WWOX gene is associated with Epstein-Barr virus-associated gastric carcinomas.
More...

AA Sequence

MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDEN      1 - 70
GQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFET     71 - 140
AKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCN    141 - 210
AATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRL    211 - 280
SPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTK    281 - 350
SMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG          351 - 414
//

Text Mined References (204)

PMID Year Title
26857392 2016 Relevance of Sp Binding Site Polymorphism in WWOX for Treatment Outcome in Pancreatic Cancer.
26592150 2015 Pc2-mediated SUMOylation of WWOX is essential for its suppression of DU145 prostate tumorigenesis.
26499798 2015 Pleiotropic Functions of Tumor Suppressor WWOX in Normal and Cancer Cells.
26345274 2015 Severe CNS involvement in WWOX mutations: Description of five new cases.
26166818 2015 MicroRNA-134 regulates lung cancer cell H69 growth and apoptosis by targeting WWOX gene and suppressing the ERK1/2 signaling pathway.
26120275 2015 Expression of WW domain-containing oxidoreductase WWOX in pterygium.
26041563 2015 HGF and TGF?1 differently influenced Wwox regulatory function on Twist program for mesenchymal-epithelial transition in bone metastatic versus parental breast carcinoma cells.
25892250 2015 The role of WWOX tumor suppressor gene in the regulation of EMT process via regulation of CDH1-ZEB1-VIM expression in endometrial cancer.
25891642 2015 Effect of the WWOX gene on the regulation of the cell cycle and apoptosis in human ovarian cancer stem cells.
25720522 2015 Aberrant gene promoter methylation of p16, FHIT, CRBP1, WWOX, and DLC-1 in Epstein-Barr virus-associated gastric carcinomas.
More...