Property Summary

NCBI Gene PubMed Count 48
PubMed Score 237.98
PubTator Score 38.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Atopic dermatitis 1.500 2.6e-02
Breast cancer -1.400 1.4e-04
Endometriosis -1.188 1.5e-02
ependymoma 3.300 1.2e-08
interstitial cystitis -2.400 3.2e-02
intraductal papillary-mucinous adenoma (... 2.300 1.9e-03
intraductal papillary-mucinous carcinoma... 2.100 3.0e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.1e-02
invasive ductal carcinoma -1.743 4.6e-02
lung adenocarcinoma 1.186 2.6e-03
lung cancer -6.500 1.4e-06
lung carcinoma 1.200 1.5e-07
non-small cell lung cancer 1.299 2.5e-07
ovarian cancer 1.600 1.3e-05
pancreatic cancer 1.100 4.0e-04
pancreatic ductal adenocarcinoma liver m... 2.962 2.2e-02
psoriasis 3.200 1.9e-10
spina bifida -2.797 3.0e-02
tuberculosis -1.700 6.7e-05

Gene RIF (22)

AA Sequence

MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDA      1 - 70
NCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIM     71 - 140
NTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLW    141 - 210
EFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVD    211 - 280
GRRLVYKFGKNARGWRENEN                                                      281 - 300
//

Text Mined References (49)

PMID Year Title