Property Summary

NCBI Gene PubMed Count 42
Grant Count 8
R01 Count 6
Funding $1,498,641.58
PubMed Score 222.25
PubTator Score 38.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
25950810 This study suggests that ESE3 plays an important role in the carcinogenesis of Esophageal Squamous Cell Carcinoma through changes in subcellular localization and may act as a tumor suppressor gene in Esophageal Squamous Cell Carcinoma.
24219556 Results suggest PPAR-gamma to be involved in the regulation of ESE-3b expression during monocyte-derived dendritic cells (moDCs) development and that ESE-3 expression is not correlated with the immunogenicity of dendritic cells (DCs).
24105369 EHF modifies the CF phenotype by altering capabilities of the epithelial cell to correctly process the folding and trafficking of mutant p.Phe508del-CFTR.
23439650 The SRC family tyrosine kinase HCK and the ETS family transcription factors SPIB and EHF regulate transcytosis across a human follicle-associated epithelium model.
23185370 ESE-3b is the functionally most important ESE-3 isoform in dendritic cells
22505649 Low ESE3/EHF expression was also associated with increased biochemical recurrence of prostate cancer and reduced overall survival after prostatectomy
21855111 EHF mRNA levels differentiate ovarian carcinoma from malignant mesothelioma. EHF may be a novel prognostic marker in ovarian carcinoma.
21617703 These results indicate that EHF-mediated RUVBL1 expression allows colon tumour cells to avoid p53-mediated apoptosis.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18475289 ESE-1 and ESE-3 play an important role in airway inflammation.
More...

AA Sequence

MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDA      1 - 70
NCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIM     71 - 140
NTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLW    141 - 210
EFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVD    211 - 280
GRRLVYKFGKNARGWRENEN                                                      281 - 300
//

Text Mined References (43)

PMID Year Title
25950810 2015 Abnormal Localization and Tumor Suppressor Function of Epithelial Tissue-Specific Transcription Factor ESE3 in Esophageal Squamous Cell Carcinoma.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24219556 2014 Activation of peroxisome proliferator-activated receptor gamma leads to upregulation of ESE-3 expression in human monocyte-derived dendritic cells.
24105369 2014 The CF-modifying gene EHF promotes p.Phe508del-CFTR residual function by altering protein glycosylation and trafficking in epithelial cells.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23439650 2013 The SRC family tyrosine kinase HCK and the ETS family transcription factors SPIB and EHF regulate transcytosis across a human follicle-associated epithelium model.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23185370 2012 Expression of ESE-3 isoforms in immunogenic and tolerogenic human monocyte-derived dendritic cells.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22505649 2012 ESE3/EHF controls epithelial cell differentiation and its loss leads to prostate tumors with mesenchymal and stem-like features.
More...