Property Summary

NCBI Gene PubMed Count 18
Grant Count 72
R01 Count 43
Funding $9,530,807.43
PubMed Score 11.95
PubTator Score 270.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma -1.300 0.027
ependymoma -1.500 0.020
osteosarcoma -1.261 0.000
medulloblastoma -1.400 0.000
juvenile dermatomyositis -1.165 0.000
Breast cancer 2.300 0.030
adult high grade glioma -1.300 0.006
lung adenocarcinoma 1.859 0.000
ulcerative colitis -1.300 0.000
ovarian cancer 1.100 0.002
dermatomyositis -1.700 0.006

Synonym

Accession Q9NZC3 O43334 Q6PKF7 Q7KYR4
Symbols MIR16
363E6.2

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
26061016 Quercetin decreases claudin-2 expression mediated by up-regulation of miR-16 expression and instability of claudin-2 mRNA in lung adenocarcinoma cells.
26033453 Our data indicate differential concentrations of plasma miR-16, miR-107, miR-130a and miR-146a in different breast cancer subtypes, suggesting a potential role of these miRs in breast cancer biology and tumor progression.
25743273 YAP1 was confirmed to be a functional target of miR-15a and miR-16-1 in GAC.
24336073 miR-16 and miR-26a target checkpoint kinases Wee1 and Chk1 in response to p53 activation by genotoxic stress.
23405235 Up-regulation of miR-16 is associated with triple negative breast cancer.
22463747 This study demonistrated that miR-15a and 16-1 are downregulated in CD4+ T cells of multiple sclerosis relapsing patients.
21081469 miR-16 and miR-21 are directly regulated by the transcription factor NF-kappaB and yet nicotine-promoted cell proliferation is mediated via EP2/4 receptors.
20668064 Results suggest an important role of miR-16 in the regulation of Wip1 phosphatase in the DNA damage response and mammary tumorigenesis.
20031211 These findings suggest that genes other than miR-15a and miR-16 may explain the prognostic significance of 13q14 deletions in patients with multiple myeloma
18227059 Glycerophosphodiesterase has robust activity on glycerophospho-N-acyl ethanolamines (GP-NAEs) which are precursors for the N-acyl ethanolamines including the endocannabinoid anandamide. Thus, GDE1 may participate in anandamide biosynthesis.
More...

AA Sequence

MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAH      1 - 70
RGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPA     71 - 140
ANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQLYNNSVVCSFLPEVI    141 - 210
YKMRQTDRDVITALTHRPWSLSHTGDGKPRYDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDF    211 - 280
VSPAYLKKWSAKGIQVVGWTVNTFDEKSYYESHLGSSYITDSMVEDCEPHF                       281 - 331
//

Text Mined References (18)

PMID Year Title
26061016 2015 Quercetin Decreases Claudin-2 Expression Mediated by Up-Regulation of microRNA miR-16 in Lung Adenocarcinoma A549 Cells.
26033453 2015 Aberrant plasma levels of circulating miR-16, miR-107, miR-130a and miR-146a are associated with lymph node metastasis and receptor status of breast cancer patients.
25743273 2015 Targeting of YAP1 by microRNA-15a and microRNA-16-1 exerts tumor suppressor function in gastric adenocarcinoma.
24336073 2013 miR-16 and miR-26a target checkpoint kinases Wee1 and Chk1 in response to p53 activation by genotoxic stress.
23405235 2013 Integrated microRNA and mRNA signatures associated with survival in triple negative breast cancer.
22463747 2012 miR-15a and 16-1 are downregulated in CD4+ T cells of multiple sclerosis relapsing patients.
21464471 2011 White lupin cluster root acclimation to phosphorus deficiency and root hair development involve unique glycerophosphodiester phosphodiesterases.
21081469 2011 NF-?B targets miR-16 and miR-21 in gastric cancer: involvement of prostaglandin E receptors.
20668064 2010 Oncogenic Wip1 phosphatase is inhibited by miR-16 in the DNA damage signaling pathway.
20031211 2010 Micro-RNA-15a and micro-RNA-16 expression and chromosome 13 deletions in multiple myeloma.
More...