Property Summary

NCBI Gene PubMed Count 90
Grant Count 79
R01 Count 40
Funding $13,894,227.99
PubMed Score 219.62
PubTator Score 157.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 0.002
psoriasis 1.200 0.000
osteosarcoma 2.764 0.000
astrocytoma 2.200 0.006
glioblastoma 3.300 0.001
pediatric high grade glioma 1.200 0.003
group 3 medulloblastoma -1.100 0.006
pilocytic astrocytoma 1.300 0.000
subependymal giant cell astrocytoma 2.310 0.008
invasive ductal carcinoma 1.706 0.000
lung carcinoma -1.400 0.000
ductal carcinoma in situ 1.200 0.023

Synonym

Accession Q9NZC2 Q8N5H8 Q8WYN6 TREM-2
Symbols TREM-2
Trem2a
Trem2b
Trem2c

Gene

Gene RIF (87)

PMID Text
26949937 miRNA-34a-mediated modulation of TREM2 may in part regulate the phagocytic response
26911435 Genome-wide association studies have identified variants of the gene that encodes triggering receptor expressed on myeloid cells 2 (TREM2) as risk factors for non-familial Alzheimer disease (AD).
26758262 Our results corroborate and extend previous findings, concluding that the variant rs75932628-T (p.R47H) in TREM2 is not a risk factor for leucoaraiosis or Parkinson's disease in the Han Chinese population.
26754172 CSF concentrations of soluble TREM2 are higher in Alzheimer's disease than in controls
26704436 neither variant rs75932628 nor rs2234253 be a major susceptibility factor of sporadic Parkinson disease in Chinese Han population from Mainland China.
26694609 The selective expression of TREM2 on myeloid cells and microglia and its association with different forms of dementia indicate a contribution of TREM2 and mutations in TREM2 in common pathways of neurodegeneration. [REVIEW]
26651418 Variant p.R47H of TREM2 was not associated with Parkinson's disease
26414614 decreased TREM2 expression with CD33 suppression and elevated cortical TREM2 mRNA expression with amyloid pathology
26384438 study to determine soluble TREM-1 and TREM-2 levels in serum, and membrane-bound TREM-1 and TREM-2 on peripheral blood mononuclear cells of patients with pulmonary TB
26374899 data demonstrate that apoE-TREM2 interaction in microglia plays critical roles in modulating phagocytosis of apoE-bound apoptotic neurons and establish a critical link between two proteins whose genes are strongly linked to the risk for AD
More...

AA Sequence

MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLW      1 - 70
LLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGD     71 - 140
LWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSE    141 - 210
LDCGHDPGYQLQTLPGLRDT                                                      211 - 230
//

Text Mined References (90)

PMID Year Title
26949937 2016 microRNA-34a-Mediated Down-Regulation of the Microglial-Enriched Triggering Receptor and Phagocytosis-Sensor TREM2 in Age-Related Macular Degeneration.
26911435 2016 TREM2 variants: new keys to decipher Alzheimer disease pathogenesis.
26758262 2016 Association study of TREM2 polymorphism rs75932628 with leucoaraiosis or Parkinson's disease in the Han Chinese population.
26754172 2016 Increased cerebrospinal fluid soluble TREM2 concentration in Alzheimer's disease.
26704436 2016 Genetic analysis of TREM2 variants in Chinese Han patients with sporadic Parkinson's disease.
26694609 2016 The Triggering Receptor Expressed on Myeloid Cells 2: A Molecular Link of Neuroinflammation and Neurodegenerative Diseases.
26651418 2016 TREM2 rare variant p.R47H is not associated with Parkinson's disease.
26414614 2015 CD33 modulates TREM2: convergence of Alzheimer loci.
26384438 2015 Soluble and cell-associated triggering receptor expressed on myeloid cells-1 and -2 in patients with pulmonary tuberculosis.
26374899 2015 Apolipoprotein E Is a Ligand for Triggering Receptor Expressed on Myeloid Cells 2 (TREM2).
More...