Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.89
PubTator Score 10.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Molybdenum cofactor deficiency 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Encephalomalacia 3 3.761 1.9

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.078 9.0e-03
active ulcerative colitis -1.700 1.1e-02
Breast cancer -2.300 3.0e-02
ductal carcinoma in situ -1.300 2.2e-03
invasive ductal carcinoma -1.500 5.0e-03
lung adenocarcinoma -1.100 1.2e-11
malignant mesothelioma 1.100 1.2e-05
medulloblastoma, large-cell -1.200 1.7e-05
non-small cell lung cancer -1.015 1.0e-13
oligodendroglioma -1.100 3.4e-02
osteosarcoma -2.542 2.5e-08
sarcoidosis 1.300 3.8e-02

Gene RIF (3)

AA Sequence

MAARPLSRMLRRLLRSSARSCSSGAPVTQPCPGESARAASEEVSRRRQFLREHAAPFSAFLTDSFGRQHS      1 - 70
YLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVA     71 - 140
QLQRLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELG    141 - 210
YNPVKVNCVVMRGLNEDELLDFAALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEK    211 - 280
VPEEESSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQE    281 - 350
LLRIIGAAVGRKKRQHAGMFSISQMKNRPMILIELFLMFPNSPPANPSIFSWDPLHVQGLRPRMSFSSQV    351 - 420
ATLWKGCRVPQTPPLAQQRLGSGSFQRHYTSRADSDANSKCLSPGSWASAAPSGPQLTSEQLTHVDSEGR    421 - 490
AAMVDVGRKPDTERVAVASAVVLLGPVAFKLVQQNQLKKGDALVVAQLAGVQAAKVTSQLIPLCHHVALS    491 - 560
HIQVQLELDSTRHAVKIQASCRARGPTGVEMEALTSAAVAALTLYDMCKAVSRDIVLEEIKLISKTGGQR    561 - 630
GDFHRA                                                                    631 - 636
//

Text Mined References (31)

PMID Year Title