Property Summary

NCBI Gene PubMed Count 22
PubMed Score 19.80
PubTator Score 10.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 1.02771454678115E-13
lung adenocarcinoma 2714 1.24283209774452E-11
osteosarcoma 7933 2.53822509243429E-8
malignant mesothelioma 3163 1.21127641414761E-5
medulloblastoma, large-cell 6234 1.65775094500737E-5
ductal carcinoma in situ 1745 9.70464679419195E-4
invasive ductal carcinoma 2950 0.00463282346554868
active ulcerative colitis 477 0.00943188315302923
active Crohn's disease 918 0.0271747464793699
Breast cancer 3099 0.0297400867071578
oligodendroglioma 2849 0.0335280769814091
sarcoidosis 368 0.0376325556092784
Disease Target Count Z-score Confidence
Encephalomalacia 3 3.8 1.9
Microcephaly 149 3.023 1.5

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
oligodendroglioma -1.100 0.034
osteosarcoma -2.542 0.000
medulloblastoma, large-cell -1.200 0.000
non-small cell lung cancer -1.015 0.000
active Crohn's disease -1.595 0.027
active ulcerative colitis -2.045 0.009
Breast cancer -2.300 0.030
sarcoidosis 1.300 0.038
lung adenocarcinoma -1.100 0.000
ductal carcinoma in situ -1.600 0.001
invasive ductal carcinoma -2.000 0.005

Gene

  Ortholog (8)

Gene RIF (3)

PMID Text
17065069 genetic and protein structural analysis of MOCS1 in molybdenum cofactor deficiency [case report]
15180982 MOCS1A is an oxygen-sensitive iron-sulfur protein involved in human molybdenum cofactor biosynthesis
12754701 Review: A total of 32 different disease-causing mutations, including several common to more than one family, have been identified in molybdenum cofactor-deficient patients and their relatives

AA Sequence

MAARPLSRMLRRLLRSSARSCSSGAPVTQPCPGESARAASEEVSRRRQFLREHAAPFSAFLTDSFGRQHS      1 - 70
YLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVA     71 - 140
QLQRLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELG    141 - 210
YNPVKVNCVVMRGLNEDELLDFAALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEK    211 - 280
VPEEESSTAKAFKIPGFQGQISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQE    281 - 350
LLRIIGAAVGRKKRQHAGMFSISQMKNRPMILIELFLMFPNSPPANPSIFSWDPLHVQGLRPRMSFSSQV    351 - 420
ATLWKGCRVPQTPPLAQQRLGSGSFQRHYTSRADSDANSKCLSPGSWASAAPSGPQLTSEQLTHVDSEGR    421 - 490
AAMVDVGRKPDTERVAVASAVVLLGPVAFKLVQQNQLKKGDALVVAQLAGVQAAKVTSQLIPLCHHVALS    491 - 560
HIQVQLELDSTRHAVKIQASCRARGPTGVEMEALTSAAVAALTLYDMCKAVSRDIVLEEIKLISKTGGQR    561 - 630
GDFHRA                                                                    631 - 636
//

Text Mined References (24)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19793632 2010 Functional deficiencies of sulfite oxidase: Differential diagnoses in neonates presenting with intractable seizures and cystic encephalomalacia.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19544009 2009 An unusual genetic variant in the MOCS1 gene leads to complete missplicing of an alternatively spliced exon in a patient with molybdenum cofactor deficiency.
17065069 2006 A Turkish case with molybdenum cofactor deficiency.
16429380 2005 Molybdenum cofactor deficiency presenting as neonatal hyperekplexia: a clinical, biochemical and genetic study.
16021469 2005 Ten novel mutations in the molybdenum cofactor genes MOCS1 and MOCS2 and in vitro characterization of a MOCS2 mutation that abolishes the binding ability of molybdopterin synthase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15180982 2004 Characterization of MOCS1A, an oxygen-sensitive iron-sulfur protein involved in human molybdenum cofactor biosynthesis.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...