Property Summary

NCBI Gene PubMed Count 23
PubMed Score 108.87
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.500 4.4e-03
ependymoma 1.400 2.0e-02
hereditary spastic paraplegia -1.198 2.3e-02
intraductal papillary-mucinous carcinoma... 1.200 2.3e-03
intraductal papillary-mucinous neoplasm ... 1.100 9.7e-03
lung adenocarcinoma 1.282 5.4e-10
lung cancer 1.300 1.3e-02
Multiple myeloma 1.378 4.1e-03
non primary Sjogren syndrome sicca 1.100 2.8e-02
osteosarcoma 2.464 2.4e-07
ovarian cancer -1.700 3.1e-06
psoriasis 1.100 3.2e-04
Rheumatoid arthritis 1.600 3.6e-03
subependymal giant cell astrocytoma 1.223 6.7e-03
Waldenstrons macroglobulinemia 1.121 4.5e-02

Gene RIF (5)

AA Sequence

MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQ      1 - 70
WNHMLGYLAALAKACFGGNIELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLP     71 - 140
PVCMAHCIRLALIRFHVKVAQSIEDHHQEVIGFCRENGFHGLVAYDSDYALCNIPYYFSAHALKLSRNGK    141 - 210
SLTTSQYLMHEVAKQLDLNPNRFPIFAALLGNHILPDEDLASFHWSLLGPEHPLASLKVRAHQLVLPPCD    211 - 280
VVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPF    281 - 350
GMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSN    351 - 420
IPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSE    421 - 490
PQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAE    491 - 560
HRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTERLAFRK    561 - 630
NRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTP    631 - 700
AMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLS    701 - 770
ALFMSGVDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQ    771 - 840
SVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAF    841 - 910
RVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGP    911 - 980
ARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSDGSLA    981 - 1050
ENGVMAEEKPAPQMNGSTGDARAPSHSESALNNDSKTCNTNPHLNALSTDSACRREAALEAAVLNKEE     1051 - 1118
//

Text Mined References (30)

PMID Year Title