Property Summary

NCBI Gene PubMed Count 29
PubMed Score 9.78
PubTator Score 10.31

Knowledge Summary

Patent (1,412)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Deafness, Autosomal Recessive 103 1 0.0 0.0
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 0.8
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0
Disease Target Count Z-score Confidence
Juvenile myoclonic epilepsy 21 3.013 1.5

Expression

  Differential Expression (33)

Disease log2 FC p
astrocytic glioma -1.900 3.3e-03
Astrocytoma, Pilocytic -1.900 3.0e-08
atypical teratoid / rhabdoid tumor -1.900 3.1e-04
breast carcinoma -1.500 1.2e-04
cystic fibrosis -1.300 9.7e-04
cystic fibrosis and chronic rhinosinusit... -1.085 4.3e-02
Duchenne muscular dystrophy -1.001 3.7e-05
ductal carcinoma in situ -2.200 1.1e-04
ependymoma -2.000 7.7e-03
fibroadenoma -1.100 2.6e-02
gastric cancer 1.500 6.9e-04
glioblastoma -1.200 2.8e-02
group 3 medulloblastoma -2.100 7.6e-04
hepatocellular carcinoma 1.100 1.9e-03
hereditary spastic paraplegia -1.134 5.6e-03
intraductal papillary-mucinous adenoma (... -1.600 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.100 4.4e-02
invasive ductal carcinoma -2.500 6.2e-04
lung adenocarcinoma -2.600 5.3e-17
lung cancer -4.800 5.3e-06
lung carcinoma -3.900 8.8e-37
malignant mesothelioma 3.800 2.2e-09
medulloblastoma, large-cell -2.500 2.6e-05
nasopharyngeal carcinoma -1.300 1.4e-03
non-small cell lung cancer -5.513 1.6e-37
oligodendroglioma -1.500 9.5e-03
osteosarcoma 1.612 3.4e-02
ovarian cancer -3.300 1.7e-06
pediatric high grade glioma -1.600 3.3e-04
pituitary cancer -1.900 3.5e-05
primitive neuroectodermal tumor -1.800 9.9e-05
psoriasis -1.400 1.6e-08
tuberculosis -1.800 4.0e-05

Gene RIF (11)

AA Sequence

MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVSVYTIKGEETS      1 - 70
LASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLCAAELQENGSVMKEDLPSPSS     71 - 140
FTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNV    141 - 210
TTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSK    211 - 280
FSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPK    281 - 350
LHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS              351 - 410
//

Text Mined References (29)

PMID Year Title