Property Summary

NCBI Gene PubMed Count 28
Grant Count 2
Funding $51,750
PubMed Score 9.53
PubTator Score 10.31

Knowledge Summary

Patent (1,412)

Expression

  Differential Expression (32)

Synonym

Accession Q9NZA1 B3KUF1 Q5T4Z0 Q8NBY3 Q96JT5 Q9BWZ0
Symbols MST130
DFNB102
DFNB103
MSTP130

Gene

 Grant Application (2)

Gene RIF (10)

PMID Text
26135398 EZR, CLIC5 and PODXL are overexpressed in hepatocellular carcinoma and may have a role in cell migration and invasiveness
25344252 The mechanism of CLIC5A action involves clustered plasma membrane phosphatidylinositol 4,5-bisphosphate accumulation, in turn facilitating ezrin activation and actin-dependent cell surface remodeling.
24781754 CLIC5 is a novel gene involved in progressive hearing impairment, vestibular and possibly mild renal dysfunction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335315 CLIC5A colocalizes with ezrin and podocalyxin in podocytes and is required for the development/maintenance of the proper glomerular endothelial cell and podocyte architecture.
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18028448 Data showed that CLIC1 and CLIC5, but not CLIC4, were strongly and reversibly inhibited (or inactivated) by F-actin.
17492382 CLIC5 was demonstrated in cultured lymphoblasts.
15184393 CLIC-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton
12163479 association with Golgi apparatus AKAP350

AA Sequence

MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVSVYTIKGEETS      1 - 70
LASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLCAAELQENGSVMKEDLPSPSS     71 - 140
FTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNV    141 - 210
TTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSK    211 - 280
FSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPK    281 - 350
LHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS              351 - 410
//

Text Mined References (28)

PMID Year Title
26135398 2015 Co-Expression of Ezrin-CLIC5-Podocalyxin Is Associated with Migration and Invasiveness in Hepatocellular Carcinoma.
25344252 2014 Clustered PI(4,5)P? accumulation and ezrin phosphorylation in response to CLIC5A.
24781754 2015 Progressive hearing loss and vestibular dysfunction caused by a homozygous nonsense mutation in CLIC5.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
20946665 2010 A multigene predictor of metastatic outcome in early stage hormone receptor-negative and triple-negative breast cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20335315 2010 CLIC5A, a component of the ezrin-podocalyxin complex in glomeruli, is a determinant of podocyte integrity.
20055760 2010 The CLIC5 (chloride intracellular channel 5) involved in C2C12 myoblasts proliferation and differentiation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...