Property Summary

NCBI Gene PubMed Count 43
PubMed Score 71.48
PubTator Score 43.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 2.0e-06
medulloblastoma -1.200 4.1e-06
medulloblastoma, large-cell -2.200 1.9e-07
osteosarcoma 1.163 4.6e-06
psoriasis -1.300 5.2e-04

Gene RIF (25)

AA Sequence

MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQYL      1 - 70
GVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNED     71 - 140
CLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGS    141 - 210
YMEGTGNMIDGSILASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPR    211 - 280
RITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVD    281 - 350
CLRQKSAKELVEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDP    351 - 420
EDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTDHQWVEPSVVT    421 - 490
ADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTY    491 - 560
WTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRATKVAFWKHLVPH    561 - 630
LYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVEN    631 - 700
PRDYSTELSVTIAVGASLLFLNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLGP    701 - 770
THHECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLP    771 - 840
HSHSTTRV                                                                  841 - 848
//

Text Mined References (47)

PMID Year Title