Property Summary

NCBI Gene PubMed Count 40
Grant Count 26
R01 Count 5
Funding $3,366,296.39
PubMed Score 63.37
PubTator Score 43.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.300 0.001
osteosarcoma 1.163 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.200 0.000
pilocytic astrocytoma 1.400 0.000

Gene RIF (23)

PMID Text
25913192 The synaptic protein neuroligin-3 (NLGN3) was identified as the leading candidate mitogen, and soluble NLGN3 was sufficient and necessary to promote robust high-grade glioma cell proliferation.
24570023 Our data provided a further evidence for the involvement of NLGN3 and NLGN4X gene in the pathogenesis of autism in Chinese population.
23851596 The present study explores, for the first time, the contribution of NLGN3 and NLGN4X genetic variants in Greek patients with autistic disorder.
23468870 Lack of association between NLGN3, NLGN4, SHANK2 and SHANK3 gene variants and autism spectrum disorder in a Chinese population.
23431752 Neuroligins are adhesion proteins that bind to beta-neurexin to form functional synapses.
22671294 Data from studies using cross-linking reagents suggest that neuroligins form dimers, including homodimers and, most notably, neuroligin 1/3 heteromers; autism-associated neuroligin mutant (neuroligin 3 R471C) forms heterodimers with neuroligin 1.
21569590 study provides initial evidence that a common variant in NLGN3 gene may play a role in the etiology of ASDs among affected males in Chinese Han population.
20227402 further characterization of the R451C mutation in NLGN3;role in protein folding
19645625 Observational study of gene-disease association. (HuGE Navigator)
19406211 these data support the hypothesis that the autism-associated NL3 mutation affects information processing in neuronal networks by altering network architecture and synchrony
More...

AA Sequence

MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQYL      1 - 70
GVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNED     71 - 140
CLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGS    141 - 210
YMEGTGNMIDGSILASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPR    211 - 280
RITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVD    281 - 350
CLRQKSAKELVEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDP    351 - 420
EDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTDHQWVEPSVVT    421 - 490
ADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTY    491 - 560
WTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRATKVAFWKHLVPH    561 - 630
LYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVEN    631 - 700
PRDYSTELSVTIAVGASLLFLNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLGP    701 - 770
THHECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLP    771 - 840
HSHSTTRV                                                                  841 - 848
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25913192 2015 Neuronal Activity Promotes Glioma Growth through Neuroligin-3 Secretion.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24570023 2014 Variations analysis of NLGN3 and NLGN4X gene in Chinese autism patients.
23851596 2013 Mutation screening in the Greek population and evaluation of NLGN3 and NLGN4X genes causal factors for autism.
23468870 2013 Lack of association between NLGN3, NLGN4, SHANK2 and SHANK3 gene variants and autism spectrum disorder in a Chinese population.
23431752 2012 Analysis of the genes encoding neuroligins NLGN3 and NLGN4 in Bulgarian patients with autism.
22671294 2012 Homodimerization and isoform-specific heterodimerization of neuroligins.
21569590 2011 A sex-specific association of common variants of neuroligin genes (NLGN3 and NLGN4X) with autism spectrum disorders in a Chinese Han cohort.
More...