Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.79
PubTator Score 5.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (3)

AA Sequence

MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPG      1 - 70
CQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSS     71 - 140
SSSSSDSD                                                                  141 - 148
//

Text Mined References (15)

PMID Year Title