Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.29
PubTator Score 5.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
non-small cell lung carcinoma 413

Expression

Gene RIF (3)

PMID Text
24362794 High Txr1 expression is associated with oxaliplatin resistance in gastric cancer.
21157449 Low TXR1 mRNA levels were associated with higher response rate (RR), longer median progression-free survival (PFS) and median overall survival (mOS), whereas high TSP1 expression was correlated with higher RR, longer PFS and mOS
19435835 Multivariate analysis showed that high TXR1/low TSP1 expression was an independent prognostic factor for decreased median time to tumor progression (TTP) and median overall survival (mOS).

AA Sequence

MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPG      1 - 70
CQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSS     71 - 140
SSSSSDSD                                                                  141 - 148
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24362794 2014 Txr1: an important factor in oxaliplatin resistance in gastric cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21157449 2011 Correlation of BRCA1, TXR1 and TSP1 mRNA expression with treatment outcome to docetaxel-based first-line chemotherapy in patients with advanced/metastatic non-small-cell lung cancer.
19435835 2009 Tumoral expression of TXR1 and TSP1 predicts overall survival of patients with lung adenocarcinoma treated with first-line docetaxel-gemcitabine regimen.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16847352 2006 Txr1: a transcriptional regulator of thrombospondin-1 that modulates cellular sensitivity to taxanes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...