Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.96
PubTator Score 11.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q9NZ72 B3KSQ5 B7WP52 B7Z5G4 O75527 Q969Y4
Symbols SCLIP

Gene

Gene RIF (8)

PMID Text
25511414 our findings demonstrate that SCLIP plays an important role in glioma pathology, and may represent a novel therapeutic strategy against human glioma.
25028095 Overexpression of ID1 in two different cell lines induced STMN3 and GSPT1 at the transcriptional level, while depletion of ID1 reduced their expression.
24589734 STMN and SCG10 are similarly targeted by JNK but there are clear differences in JNK recognition and phosphorylation of the closely related family member, SCLIP.
23543364 We found that reduced expression and possibly posttranslational modification of SCLIP following paclitaxel treatment impaired the microtubule-destabilizing effect of SCLIP
22577147 Specific serine-proline phosphorylation and glycogen synthase kinase 3beta-directed subcellular targeting of stathmin 3/Sclip in neurons
19824884 Studies suggest that a STAT3-SCLIP interaction is required to preserve SCLIP stability and contributes to the maintenance of normal epithelial morphology.
18549247 SCLIP and SCG10 were colocalized to the Golgi apparatus of chromaffin cells in vivo and shared localization with CHGA as it transited the Golgi.
12676564 The substantial expression of SCLIP in most tissues points out a novel function outside the nervous system and raises the possibility that its coexpression with stathmin could provide some degree of functional redundancy.

AA Sequence

MASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSPESPM      1 - 70
LSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKM     71 - 140
ELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG                                  141 - 180
//

Text Mined References (20)

PMID Year Title
25511414 2015 Overexpression of SCLIP promotes growth and motility in glioblastoma cells.
25028095 2014 Nicotine-mediated invasion and migration of non-small cell lung carcinoma cells by modulating STMN3 and GSPT1 genes in an ID1-dependent manner.
24589734 2014 Differences in c-Jun N-terminal kinase recognition and phosphorylation of closely related stathmin-family members.
23543364 2013 Bisphosphorylated PEA-15 sensitizes ovarian cancer cells to paclitaxel by impairing the microtubule-destabilizing effect of SCLIP.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22577147 2012 Specific serine-proline phosphorylation and glycogen synthase kinase 3?-directed subcellular targeting of stathmin 3/Sclip in neurons.
21471001 2011 Subcellular Golgi localization of stathmin family proteins is promoted by a specific set of DHHC palmitoyl transferases.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
19824884 2009 SCG10-like protein (SCLIP) is a STAT3-interacting protein involved in maintaining epithelial morphology in MCF-7 breast cancer cells.
18549247 2008 The trans-Golgi proteins SCLIP and SCG10 interact with chromogranin A to regulate neuroendocrine secretion.
More...