Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.13
PubTator Score 11.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 4.1e-03
astrocytic glioma -1.400 2.6e-02
Astrocytoma, Pilocytic -1.300 8.1e-10
atypical teratoid / rhabdoid tumor -1.200 7.1e-03
ependymoma -1.800 4.7e-02
glioblastoma -1.200 6.4e-07
intraductal papillary-mucinous adenoma (... -2.000 2.9e-06
intraductal papillary-mucinous carcinoma... -2.000 3.9e-05
medulloblastoma, large-cell -1.500 5.3e-05
osteosarcoma -1.628 2.2e-02
ovarian cancer -2.300 1.9e-08

Gene RIF (8)

AA Sequence

MASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSPESPM      1 - 70
LSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKM     71 - 140
ELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG                                  141 - 180
//

Text Mined References (20)

PMID Year Title