Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.02
PubTator Score 0.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.7e-05
ovarian cancer 8520 8.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.711 4.7e-05
ovarian cancer 1.100 8.8e-03

Synonym

Accession Q9NZ63 B3KPX8 Q8WVU6 Q9NT39
Symbols HCA59
HSPC220
bA409K20.3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQ      1 - 70
MKTGGMVDMKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKGIVEHEEQKVKPK     71 - 140
NAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSET    141 - 210
SFVPTNMAVNYVQHNRFYHEELNAPIRRNKEEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYE    211 - 280
KFKKMNRRY                                                                 281 - 289
//

Text Mined References (24)

PMID Year Title