Property Summary

NCBI Gene PubMed Count 28
Grant Count 16
R01 Count 10
Funding $2,568,972.5
PubMed Score 51.79
PubTator Score 20.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.300 0.017
ependymoma 1.200 0.036
oligodendroglioma 1.200 0.027
cystic fibrosis -1.173 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
glioblastoma -1.500 0.007
medulloblastoma, large-cell -2.800 0.001
primitive neuroectodermal tumor -1.400 0.022
pediatric high grade glioma -1.100 0.011
sonic hedgehog group medulloblastoma -1.800 0.002
lung carcinoma 2.200 0.000
ovarian cancer -1.100 0.000
pituitary cancer 1.500 0.000
chronic rhinosinusitis -1.161 0.031

 GO Function (1)

Gene RIF (18)

PMID Text
26764407 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ alpha-1) and profilin 2.
26287480 This DNA damage-induced nuclear actin assembly requires two biologically and physically linked nucleation factors: Formin-2 and Spire-1/Spire-2.
25564607 We therefore characterized co-expressed Spir-2 and Fmn-2 fluorescent protein fusions . The data corroborate a model according to which Spir-2 exists in two different states, a cytosolic monomeric conformation and a membrane-bound state
25480035 FMN2 mutations link intellectual disability either directly or indirectly to the regulation of actin-mediated synaptic spine density.
24223803 miR-335 regulates the expression of at least five formin family members, three of which are validated, FMNL3, FMN2 and DAAM2.
23839046 FMN2 is a crucial protein involved in the control of p21.
23375502 results identify FMN2 as a crucial component in the regulation of p21 and consequent oncogene/stress-induced cell-cycle arrest in human cells.
21705804 analysis of the molecular basis of the Spir1/formin-2 interaction
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MGNQDGKLKRSAGDALHEGGGGAEDALGPRDVEATKKGSGGKKALGKHGKGGGGGGGGGESGKKKSKSDS      1 - 70
RASVFSNLRIRKNLSKGKGAGGSREDVLDSQALQTGELDSAHSLLTKTPDLSLSADEAGLSDTECADPFE     71 - 140
VTGPGGPGPAEARVGGRPIAEDVETAAGAQDGQRTSSGSDTDIYSFHSATEQEDLLSDIQQAIRLQQQQQ    141 - 210
QQLQLQLQQQQQQQQLQGAEEPAAPPTAVSPQPGAFLGLDRFLLGPSGGAGEAPGSPDTEQALSALSDLP    211 - 280
ESLAAEPREPQQPPSPGGLPVSEAPSLPAAQPAAKDSPSSTAFPFPEAGPGEEAAGAPVRGAGDTDEEGE    281 - 350
EDAFEDAPRGSPGEEWAPEVGEDAPQRLGEEPEEEAQGPDAPAAASLPGSPAPSQRCFKPYPLITPCYIK    351 - 420
TTTRQLSSPNHSPSQSPNQSPRIKRRPEPSLSRGSRTALASVAAPAKKHRADGGLAAGLSRSADWTEELG    421 - 490
ARTPRVGGSAHLLERGVASDSGGGVSPALAAKASGAPAAADGFQNVFTGRTLLEKLFSQQENGPPEEAEK    491 - 560
FCSRIIAMGLLLPFSDCFREPCNQNAQTNAASFDQDQLYTWAAVSQPTHSLDYSEGQFPRRVPSMGPPSK    561 - 630
PPDEEHRLEDAETESQSAVSETPQKRSDAVQKEVVDMKSEGQATVIQQLEQTIEDLRTKIAELERQYPAL    631 - 700
DTEVASGHQGLENGVTASGDVCLEALRLEEKEVRHHRILEAKSIQTSPTEEGGVLTLPPVDGLPGRPPCP    701 - 770
PGAESGPQTKFCSEISLIVSPRRISVQLDSHQPTQSISQPPPPPSLLWSAGQGQPGSQPPHSISTEFQTS    771 - 840
HEHSVSSAFKNSCNIPSPPPLPCTESSSSMPGLGMVPPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPP    841 - 910
PPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPP    911 - 980
LPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGA    981 - 1050
GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPP   1051 - 1120
PPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPL   1121 - 1190
PGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLPVSGPPLLPQVGSSTLPTPQVC   1191 - 1260
GFLPPPLPSGLFGLGMNQDKGSRKQPIEPCRPMKPLYWTRIQLHSKRDSSTSLIWEKIEEPSIDCHEFEE   1261 - 1330
LFSKTAVKERKKPISDTISKTKAKQVVKLLSNKRSQAVGILMSSLHLDMKDIQHAVVNLDNSVVDLETLQ   1331 - 1400
ALYENRAQSDELEKIEKHGRSSKDKENAKSLDKPEQFLYELSLIPNFSERVFCILFQSTFSESICSIRRK   1401 - 1470
LELLQKLCETLKNGPGVMQVLGLVLAFGNYMNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVS   1471 - 1540
YYLRNFDEDAGKEQCLFPLPEPQDLFQASQMKFEDFQKDLRKLKKDLKACEVEAGKVYQVSSKEHMQPFK   1541 - 1610
ENMEQFIIQAKIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKEN   1611 - 1680
KLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT                               1681 - 1722
//

Text Mined References (31)

PMID Year Title
26764407 2016 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ ?-1) and profilin 2.
26287480 2015 DNA damage induces nuclear actin filament assembly by Formin -2 and Spire-½ that promotes efficient DNA repair. [corrected].
25564607 2015 Membrane targeting of the Spir·formin actin nucleator complex requires a sequential handshake of polar interactions.
25480035 2014 Biallelic truncating mutations in FMN2, encoding the actin-regulatory protein Formin 2, cause nonsyndromic autosomal-recessive intellectual disability.
24489884 2014 Genome-wide association study of proneness to anger.
24223803 2013 Metastasis suppressor microRNA-335 targets the formin family of actin nucleators.
23839046 2013 FMN2 is a novel regulator of the cyclin-dependent kinase inhibitor p21.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23437003 2013 Genetic determinants of trabecular and cortical volumetric bone mineral densities and bone microstructure.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
More...