Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.07
PubTator Score 8.26

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.500 1.2e-03
atypical teratoid / rhabdoid tumor -1.200 1.2e-02
group 3 medulloblastoma 1.200 2.0e-02
invasive ductal carcinoma 1.300 3.2e-02
lung carcinoma 1.900 4.2e-44
non-small cell lung cancer 1.041 1.6e-09
subependymal giant cell astrocytoma -1.248 4.2e-02

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MGRLLRAARLPPLLSPLLLLLVGGAFLGACVAGSDEPGPEGLTSTSLLDLLLPTGLEPLDSEEPSETMGL      1 - 70
GAGLGAPGSGFPSEENEESRILQPPQYFWEEEEELNDSSLDLGPTADYVFPDLTEKAGSIEDTSQAQELP     71 - 140
NLPSPLPKMNLVEPPWHMPPREEEEEEEEEEEREKEEVEKQEEEEEEELLPVNGSQEEAKPQVRDFSLTS    141 - 210
SSQTPGATKSRHEDSGDQASSGVEVESSMGPSLLLPSVTPTTVTPGDQDSTSQEAEATVLPAAGLGVEFE    211 - 280
APQEASEEATAGAAGLSGQHEEVPALPSFPQTTAPSGAEHPDEDPLGSRTSASSPLAPGDMELTPSSATL    281 - 350
GQEDLNQQLLEGQAAEAQSRIPWDSTQVICKDWSNLAGKNYIILNMTENIDCEVFRQHRGPQLLALVEEV    351 - 420
LPRHGSGHHGAWHISLSKPSEKEQHLLMTLVGEQGVVPTQDVLSMLGDIRRSLEEIGIQNYSTTSSCQAR    421 - 490
ASQVRSDYGTLFVVLVVIGAICIIIIALGLLYNCWQRRLPKLKHVSHGEELRFVENGCHDNPTLDVASDS    491 - 560
QSEMQEKHPSLNGGGALNGPGSWGALMGGKRDPEDSDVFEEDTHL                             561 - 605
//

Text Mined References (15)

PMID Year Title