Property Summary

NCBI Gene PubMed Count 11
Grant Count 6
R01 Count 5
Funding $317,579.61
PubMed Score 4.05
PubTator Score 8.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (2)

PMID Text
18606703 findings indicate that endoglycan can function as a ligand for the vascular selectins.
12889478 endoglycan functions as an L-selectin ligand through modification with tyrosine sulfation and sialyl Lewis x

AA Sequence

MGRLLRAARLPPLLSPLLLLLVGGAFLGACVAGSDEPGPEGLTSTSLLDLLLPTGLEPLDSEEPSETMGL      1 - 70
GAGLGAPGSGFPSEENEESRILQPPQYFWEEEEELNDSSLDLGPTADYVFPDLTEKAGSIEDTSQAQELP     71 - 140
NLPSPLPKMNLVEPPWHMPPREEEEEEEEEEEREKEEVEKQEEEEEEELLPVNGSQEEAKPQVRDFSLTS    141 - 210
SSQTPGATKSRHEDSGDQASSGVEVESSMGPSLLLPSVTPTTVTPGDQDSTSQEAEATVLPAAGLGVEFE    211 - 280
APQEASEEATAGAAGLSGQHEEVPALPSFPQTTAPSGAEHPDEDPLGSRTSASSPLAPGDMELTPSSATL    281 - 350
GQEDLNQQLLEGQAAEAQSRIPWDSTQVICKDWSNLAGKNYIILNMTENIDCEVFRQHRGPQLLALVEEV    351 - 420
LPRHGSGHHGAWHISLSKPSEKEQHLLMTLVGEQGVVPTQDVLSMLGDIRRSLEEIGIQNYSTTSSCQAR    421 - 490
ASQVRSDYGTLFVVLVVIGAICIIIIALGLLYNCWQRRLPKLKHVSHGEELRFVENGCHDNPTLDVASDS    491 - 560
QSEMQEKHPSLNGGGALNGPGSWGALMGGKRDPEDSDVFEEDTHL                             561 - 605
//

Text Mined References (15)

PMID Year Title
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18987355 2008 Novel functions of the CD34 family.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18606703 2008 Endoglycan, a member of the CD34 family of sialomucins, is a ligand for the vascular selectins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16720896 2006 Beyond mere markers: functions for CD34 family of sialomucins in hematopoiesis.
16410385 2006 Na+/H+ exchanger regulatory factor-1 is a hematopoietic ligand for a subset of the CD34 family of stem cell surface proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...