Property Summary

NCBI Gene PubMed Count 43
Grant Count 43
R01 Count 23
Funding $4,466,698.7
PubMed Score 38.50
PubTator Score 36.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.092 0.001

Gene RIF (22)

PMID Text
26811329 role of GGA3 in the cell surface export of alpha2B-adrenergic receptor
26446845 This work identifies GGA3 as a key player in a novel DXXLL-mediated endosomal sorting machinery that targets TrkA to the plasma membrane, where it prolongs the activation of Akt signaling and survival responses.
24407285 These data indicate that clathrin is required for the function of AP-1- and GGA-coated carriers at the trans-Golgi network but may be dispensable for outward traffic en route to the plasma membrane.
23970038 GGA3 is involved in the cellular processes relevant for Alzheimer's disease pathogenesis.
21440067 Subcellular fractionation of Alzheimer's disease cortex with low levels of Golgi-localized GGA proteins shows an alteration of beta-secretase distribution and extensive co-localization with amyloid beta precursor protein APP.
20484053 GGA3 tightly and inversely regulate BACE1 levels via interaction with ubiquitin sorting machinery
20012524 Expression of a patient-derived HIV-1 Vpr protein reveals a significant reduction in Vpr nuclear import. Vpr F72L mutation is responsible for this decreased Vpr nuclear import and the F72L mutant is co-localized with gamma-adaptin in the Golgi apparatus
19815556 seladin-1 downregulation increases BACE1 levels and activity through enhanced GGA3 depletion during apoptosis
19788741 GGA overexpression causes various sorting defects as measured by recycling of CD-MPR, internalization of transferrin receptor, and the subcellular localization of proteins like Tsg101, ubiquitin, and Hrs.
18638397 Expression of a patient-derived HIV-1 Vpr protein reveals a significant reduction in Vpr nuclear import. Vpr F72L mutation is responsible for this decreased Vpr nuclear import and the F72L mutant is co-localized with gamma-adaptin in the Golgi apparatus
More...

AA Sequence

MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLE      1 - 70
ACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKR     71 - 140
QGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEANKLIKSMVKEDEARIQK    141 - 210
VTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDIL    211 - 280
QASDNLSRVINSYKTIIEGQVINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPS    281 - 350
SGIPILPPPPQASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLL    351 - 420
QREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAP    421 - 490
ALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSP    491 - 560
LFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVS    561 - 630
MLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFAL    631 - 700
GEQLSTEVGEVDQFPPVEQWGNL                                                   701 - 723
//

Text Mined References (48)

PMID Year Title
26811329 2016 GGA3 Interacts with a G Protein-Coupled Receptor and Modulates Its Cell Surface Export.
26477546 2015 Joubert Syndrome in French Canadians and Identification of Mutations in CEP104.
26446845 2015 GGA3 mediates TrkA endocytic recycling to promote sustained Akt phosphorylation and cell survival.
24407285 2014 Clathrin terminal domain-ligand interactions regulate sorting of mannose 6-phosphate receptors mediated by AP-1 and GGA adaptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23970038 2013 Elucidation of the BACE1 regulating factor GGA3 in Alzheimer's disease.
22836275 2012 Depletion of GGA1 and GGA3 mediates postinjury elevation of BACE1.
21664574 2011 GGA3 functions as a switch to promote Met receptor recycling, essential for sustained ERK and cell migration.
21440067 2011 Decreased expression of GGA3 protein in Alzheimer's disease frontal cortex and increased co-distribution of BACE with the amyloid precursor protein.
21269460 2011 Initial characterization of the human central proteome.
More...