Property Summary

NCBI Gene PubMed Count 37
PubMed Score 54.59
PubTator Score 55.19

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.36600752627328E-18
ependymoma 2514 2.24135106003077E-6
atypical teratoid / rhabdoid tumor 4369 4.51779184089981E-6
adult high grade glioma 2148 6.52592439995679E-5
lung cancer 4473 1.05678422055184E-4
medulloblastoma 1524 7.10033974060418E-4
glioblastoma 5572 0.0014240059854428
medulloblastoma, large-cell 6234 0.00153353389893589
astrocytoma 1493 0.00189758699422204
Pick disease 1893 0.00300403170000141
primitive neuroectodermal tumor 3031 0.00308714994945877
acute myeloid leukemia 785 0.00959660254175176
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0136963689544828
Polycystic Ovary Syndrome 335 0.0221160802947496
Breast cancer 3099 0.0260299803310367
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.36 1.7


  Differential Expression (15)

Disease log2 FC p
ependymoma -1.300 0.000
glioblastoma -1.500 0.001
astrocytoma -1.700 0.002
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma -1.300 0.001
medulloblastoma, large-cell -1.200 0.002
primitive neuroectodermal tumor -1.100 0.003
autosomal dominant Emery-Dreifuss muscul... -1.074 0.014
lung cancer 2.000 0.000
Breast cancer 3.100 0.026
adult high grade glioma -1.700 0.000
Polycystic Ovary Syndrome 1.001 0.022
lung carcinoma 1.200 0.000
Pick disease -1.100 0.003
acute myeloid leukemia -1.300 0.010


Accession Q9NZ45 Q1X902
Symbols ZCD1



2QD0   2QH7   2R13   3EW0   3LPQ   3REE   4EZF   4F1E   4F28   4F2C  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (31)

26887944 the redox-sensing function of mNT is a key component of the cellular adaptive response to help stress-sensitive Fe-S proteins recover from oxidative injury.
26778000 Our results confirm the observation that mitoNEET is important in transferring the iron sulfur clusters to the cytosolic aconitase in living cells and the His-87 ligand in mitoNEET plays important role in this process.
26692580 A possible role of CISD1 in obesity-associated dysfunctional adipogenesis in human visceral adipose tissue.
25645953 Glutathione reductase reduces mitochondrial protein mitoNEET [2Fe-2S] clusters.
25448035 Studies indicate that NEET proteins are associated with diseases including cancer and diabetes.
25168891 SNPs in three genes CYP26B1 rs2241057, CISD1 rs2251039, rs2590370, and TBX1 rs4819522 were involved in six potential pathways to influence serum prostate-specific antigen levels.
25012650 MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/IRP1.
24814435 In this review, we evaluate the current understanding regarding how mitoNEET regulates cellular bioenergetics as well as the structural requirements for drug compound association with mitoNEET
24403080 pioglitazone may modulate the function of mitoNEET by blocking the thiol-mediated reduction of [2Fe-2S] clusters in the protein.
24295216 The MitoNEET forms a covalent complex with GDH1 through disulfide bond formation and acts as an activator.

AA Sequence

YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET                                     71 - 108

Text Mined References (44)

PMID Year Title
26887944 2016 Redox Control of the Human Iron-Sulfur Repair Protein MitoNEET Activity via Its Iron-Sulfur Cluster.
26778000 2016 His-87 ligand in mitoNEET is crucial for the transfer of iron sulfur clusters from mitochondria to cytosolic aconitase.
26692580 2016 CISD1 in association with obesity-associated dysfunctional adipogenesis in human visceral adipose tissue.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645953 2015 Reduction of mitochondrial protein mitoNEET [2Fe-2S] clusters by human glutathione reductase.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25448035 2015 Structure-function analysis of NEET proteins uncovers their role as key regulators of iron and ROS homeostasis in health and disease.
25168891 2014 Pathway analysis of genome-wide association study on serum prostate-specific antigen levels.
25012650 2014 The diabetes drug target MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/iron regulatory protein 1.
24814435 2014 mitoNEET as a novel drug target for mitochondrial dysfunction.