Property Summary

Ligand Count 1
NCBI Gene PubMed Count 40
PubMed Score 62.55
PubTator Score 55.19

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.300 9.6e-03
adult high grade glioma -1.700 6.5e-05
astrocytoma -1.700 1.9e-03
atypical teratoid / rhabdoid tumor -1.800 4.5e-06
autosomal dominant Emery-Dreifuss muscul... -1.074 1.4e-02
Breast cancer 3.100 2.6e-02
ependymoma -1.300 2.2e-06
glioblastoma -1.100 3.5e-04
group 4 medulloblastoma -1.100 2.2e-03
lung cancer 2.000 1.1e-04
lung carcinoma 1.200 1.4e-18
medulloblastoma, large-cell -1.200 1.5e-03
Pick disease -1.100 3.0e-03
Polycystic ovary syndrome 1.001 2.2e-02
primitive neuroectodermal tumor -1.100 3.1e-03

Gene RIF (34)

AA Sequence

YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET                                     71 - 108

Text Mined References (47)

PMID Year Title