Property Summary

NCBI Gene PubMed Count 17
Grant Count 33
R01 Count 6
Funding $9,856,441.01
PubMed Score 395.83
PubTator Score 163.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.016 0.000
diabetes mellitus -1.300 0.001
non primary Sjogren syndrome sicca 1.400 0.012

Gene RIF (5)

PMID Text
25184340 Grsf1 controls translation of the protein Use1, possibly by positioning the 40S ribosomal subunit and associated translation factors in front of the translation start site.
24528925 FAT10 ubiquitination of USE1 leads to its accelerated degradation by the proteasome.
20975683 USE1 is not only the first E2 enzyme but also the first known substrate of FAT10 conjugation, as it was efficiently auto-FAT10ylated in cis but not in trans.
19369418 Results together suggest that NAG links between p31 and ZW10-RINT-1 and is involved in Golgi-to-ER transport.
18854154 Knockdown of unconventional SNARE in the ER 1 homolog (USE1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKG      1 - 70
MLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKR     71 - 140
TGVAGSQPVSEKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQ    141 - 210
NLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKLK                         211 - 259
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25184340 2014 Grsf1-induced translation of the SNARE protein Use1 is required for expansion of the erythroid compartment.
24528925 2014 Investigations into the auto-FAT10ylation of the bispecific E2 conjugating enzyme UBA6-specific E2 enzyme 1.
21269460 2011 Initial characterization of the human central proteome.
20975683 2010 USE1 is a bispecific conjugating enzyme for ubiquitin and FAT10, which FAT10ylates itself in cis.
19369418 2009 Identification of the neuroblastoma-amplified gene product as a component of the syntaxin 18 complex implicated in Golgi-to-endoplasmic reticulum retrograde transport.
16381901 2006 The LIFEdb database in 2006.
16354670 2006 Involvement of a novel Q-SNARE, D12, in quality control of the endomembrane system.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...