Property Summary

NCBI Gene PubMed Count 18
PubMed Score 401.23
PubTator Score 163.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.300 1.1e-03
non primary Sjogren syndrome sicca 1.400 1.2e-02
osteosarcoma -1.016 7.2e-05

Protein-protein Interaction (10)

Gene RIF (6)

AA Sequence

MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKG      1 - 70
MLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKR     71 - 140
TGVAGSQPVSEKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQ    141 - 210
NLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKLK                         211 - 259
//

Text Mined References (21)

PMID Year Title