Property Summary

Ligand Count 2
NCBI Gene PubMed Count 70
PubMed Score 677.28
PubTator Score 161.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.800 1.1e-02

 MGI Phenotype (1)

Gene RIF (54)

AA Sequence

MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIV      1 - 70
LTSWITIFQIYRPRWGALGDYLSFTIPLGTP                                            71 - 101
//

Text Mined References (73)

PMID Year Title