Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NZ38
Symbols HT009
IDI2-AS
C10orf110

Gene

 Compartment GO Term (0)

AA Sequence

MAFPGQSDTKMQWPEVPALPLLSSLCMAMVRKSSALGKEVGRRSEGNGDAGGPFPAVKFPIKDIQFSESG      1 - 70
EGTRFLHGARLSPLSRNIKARLLLYVRASPLFYESRITLKKPSNRHEVKRNRCNRKTAKQMLMTTLFNEL     71 - 140
EPTRKYGITEDCTSLNRVLFSANRKCLHKSLYKKDCFKAAPFSMFSFR                          141 - 188
//

Text Mined References (5)

PMID Year Title
24036268 2013 Identification of short-lived long non-coding RNAs as surrogate indicators for chemical stress response.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.