Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -2.200 1.5e-02
atypical teratoid / rhabdoid tumor -1.200 1.9e-05
ependymoma -2.100 3.3e-02
group 3 medulloblastoma -1.100 1.8e-02
medulloblastoma, large-cell -1.300 3.2e-03
oligodendroglioma -2.200 1.9e-02

Synonym

Accession Q9NZ38
Symbols HT009
IDI2-AS
C10orf110

Gene

 Compartment GO Term (0)

AA Sequence

MAFPGQSDTKMQWPEVPALPLLSSLCMAMVRKSSALGKEVGRRSEGNGDAGGPFPAVKFPIKDIQFSESG      1 - 70
EGTRFLHGARLSPLSRNIKARLLLYVRASPLFYESRITLKKPSNRHEVKRNRCNRKTAKQMLMTTLFNEL     71 - 140
EPTRKYGITEDCTSLNRVLFSANRKCLHKSLYKKDCFKAAPFSMFSFR                          141 - 188
//

Text Mined References (5)

PMID Year Title