Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.22
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.9e-08
Pick disease 1894 6.5e-05
astrocytic glioma 2597 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Variant Creutzfeldt-Jakob disease 16 3.167 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 2.9e-02
ovarian cancer -2.000 1.9e-08
Pick disease -1.200 6.5e-05

Synonym

Accession Q9NZ32 Q9H9Y5 Q9NWY2
Symbols Arp10
Arp11
ACTR11
HARP11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKE      1 - 70
FIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLD     71 - 140
CGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTSVAKEQSLPSVMGSVPEGVLEDI    141 - 210
KARTCFVSDLKRGLKIQAAKFNIDGNNERPSPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSV    211 - 280
ATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKA    281 - 350
NCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK       351 - 417
//

Text Mined References (12)

PMID Year Title